# hmmsearch :: search profile(s) against a sequence database # HMMER 3.0 (March 2010); http://hmmer.org/ # Copyright (C) 2010 Howard Hughes Medical Institute. # Freely distributed under the GNU General Public License (GPLv3). # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: hmmermodlib/0043305.hmm # target sequence database: /u/praktikum/Downloads/Homo_sapiens.fasta # sequence reporting threshold: E-value <= 0.0001 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 0043305 [M=30] Accession: 0043305 Description: C2H2 and C2HC zinc fingers Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-11 41.8 4.6 1.3e-09 37.3 0.6 3.1 2 ENSP00000299440 pep:known chromosome:NCBI36:11:36546139:3655 Domain annotation for each sequence (and alignments): >> ENSP00000299440 pep:known chromosome:NCBI36:11:36546139:36557862:1 gene:ENSG00000166349 transcript:ENST00000299440 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.3 0.6 2.8e-14 1.3e-09 1 30 [] 354 383 .. 354 383 .. 0.96 2 ! 4.5 0.1 0.0031 1.4e+02 4 20 .. 899 915 .. 897 921 .. 0.82 Alignments for each domain: == domain 1 score: 37.3 bits; conditional E-value: 2.8e-14 0043305 1 lvvrCpvkdCdeevllgkysqhlsshkeak 30 l+v+Cp+k+C+eev+l+ky++h+sshke+k ENSP00000299440 354 LMVKCPAKECNEEVSLEKYNHHISSHKESK 383 79*************************975 PP == domain 2 score: 4.5 bits; conditional E-value: 0.0031 0043305 4 rCpvkdCdeevllgkys 20 Cp+k+C e ++ ++ ENSP00000299440 899 SCPAKECPESLCQYSFN 915 6********99877666 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (30 nodes) Target sequences: 46591 (23540008 residues) Passed MSV filter: 1705 (0.0365951); expected 931.8 (0.02) Passed bias filter: 1705 (0.0365951); expected 931.8 (0.02) Passed Vit filter: 289 (0.00620291); expected 46.6 (0.001) Passed Fwd filter: 47 (0.00100878); expected 0.5 (1e-05) Initial search space (Z): 46591 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.67u 0.06s 00:00:00.73 Elapsed: 00:00:00.26 # Mc/sec: 2716.15 //