| Links: | BOTTOM |
|
|
reference predict_h29929 (Oct 11, 2004 06:57:26) reference pred_h29929 (Oct 11, 2004 07:35:56) PPhdr from: mai01duu@studserv.uni-leipzig.de PPhdr resp: MAIL PPhdr orig: HTML PPhdr want: HTML PPhdr password(###) prediction of: - default prediction of: - ProSite SEG ProDom return msf format ret html ret store # default: single protein sequence resfilename=kk1982fj MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSF REMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY
-------------------------------------------------------------
Pattern-ID: PKC_PHOSPHO_SITE PS00005 PDOC00005
Pattern-DE: Protein kinase C phosphorylation site
Pattern: [ST].[RK]
59 SFR
Pattern-ID: CK2_PHOSPHO_SITE PS00006 PDOC00006
Pattern-DE: Casein kinase II phosphorylation site
Pattern: [ST].{2}[DE]
59 SFRE
78 SIEE
Pattern-ID: TYR_PHOSPHO_SITE PS00007 PDOC00007
Pattern-DE: Tyrosine kinase phosphorylation site
Pattern: [RK].{2,3}[DE].{2,3}Y
19 KKKIEGRLY
prot (#) default: single protein sequence resfilename=kk1982fj /home/ppuser/server/work/predict_h29929 from: 1 to: 110 prot (#) default: single protein sequence resfilename=kk1982fj /home/ppuser/server/work/predict_h29929 /home/ppuser/server/work/predict_h29929.segNormGcg Length: 110 11-Jul-99 Check: 2818 .. 1 MEWEMGLQxx xxxxxxxxxx xxxxxxYDEK RRQIKPGDVI SFEGGKLKVR 51 VKAIRVYNSF REMLEKEGLE NVLPGVKSIE EGIQVYRRFY DEEKEKKYGV 101 VAIEIEPLEY
Identities computed with respect to: (query) prot Colored by: consensus/70% and property
HSP processing: ranked
3 [ . . . . : . . . . 1 ] 106 prot (#) default: single protein... score P(N) N 100.0% WEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIE 1 PD020487 p2000.1 (3) O22861(1) O5809... 285 2.2e-25 1 51.9% WRMYLRDEYIEMIKAGKKRIEGRLYYPQRRGMKPGDKIIFNDGELPAEVNEIHQYASFYELLKAESIEKVFPGTKTIEEGMQMFRKLYDTDQENFYGVVAIHLE consensus/100% WcMhLp-EalEhIKhtKK+IEGRLY..pRRthKPGDhI.FpsGcL.scVptI+.YsSFhEhLctEulEpVhPGsKoIEEGhQhaR+hYDp-pEphYGVVAIclE consensus/90% WcMhLp-EalEhIKhtKK+IEGRLY..pRRthKPGDhI.FpsGcL.scVptI+.YsSFhEhLctEulEpVhPGsKoIEEGhQhaR+hYDp-pEphYGVVAIclE consensus/80% WcMhLp-EalEhIKhtKK+IEGRLY..pRRthKPGDhI.FpsGcL.scVptI+.YsSFhEhLctEulEpVhPGsKoIEEGhQhaR+hYDp-pEphYGVVAIclE consensus/70% WcMhLp-EalEhIKhtKK+IEGRLY..pRRthKPGDhI.FpsGcL.scVptI+.YsSFhEhLctEulEpVhPGsKoIEEGhQhaR+hYDp-pEphYGVVAIclE |
--- ------------------------------------------------------------ --- --- Again: these results were obtained based on the domain data- --- base collected by Daniel Kahn and his coworkers in Toulouse. --- --- PLEASE quote: --- F Corpet, J Gouzy, D Kahn (1998). The ProDom database --- of protein domain families. Nucleic Ac Res 26:323-326. --- --- The general WWW page is on: ---- --------------------------------------- --- http://www.toulouse.inra.fr/prodom.html ---- --------------------------------------- --- --- For WWW graphic interfaces to PRODOM, in particular for your --- protein family, follow the following links (each line is ONE --- single link for your protein!!): --- http://www.toulouse.inra.fr/prodom/cgi-bin/ReqProdomII.pl?id_dom1=PD020487 ==> multiple alignment, consensus, PDB and PROSITE links of domain PD020487 http://www.toulouse.inra.fr/prodom/cgi-bin/ReqProdomII.pl?id_dom2=PD020487 ==> graphical output of all proteins having domain PD020487 --- --- NOTE: if you want to use the link, make sure the entire line --- is pasted as URL into your browser! --- --- END of PRODOM --- ------------------------------------------------------------
--- ------------------------------------------------------------ --- PSI-BLAST multiple sequence alignment --- ------------------------------------------------------------ --- --- PSI-BLAST ALIGNMENT HEADER: ABBREVIATIONS FOR SUMMARY --- SEQLENGTH : 110 --- ID : identifier of aligned (homologous) protein --- LSEQ2 : length of aligned sequence --- IDE : percentage of pairwise sequence identity --- SIM : percentage of similarity --- LALI : number of residues aligned --- LGAP : number of residues in all indels --- BSCORE : blast score (bits) --- BEXPECT : blast expectation value --- OMIM : OMIM (Online Mendelian Inheritance in Man) ID --- PROTEIN : one-line description of aligned protein --- '!' : indicates lower scoring alignment that is combined --- with the higher scoring adjacent one --- --- PSI-BLAST ALIGNMENT HEADER: SUMMARY ID LSEQ2 IDE SIM LALI LGAP BSCORE BEXPECT PROTEIN Q8TY14 350 50 64 103 1 132 1e-30 (Q8TY14) Archaea-specific Q8U3L1 110 83 83 110 0 129 8e-30 (Q8U3L1) Hypothetical pro O58093 109 71 81 109 0 127 4e-29 (O58093) Hypothetical pro Q9UY95 111 69 80 109 0 125 1e-28 (Q9UY95) Hypothetical pro Q6HFQ1 113 30 48 109 4 118 2e-26 (Q6HFQ1) Hypothetical pro Q81YF0 113 30 48 109 4 118 2e-26 (Q81YF0) Hypothetical pro Q813A1 113 29 47 109 4 116 1e-25 (Q813A1) Hypothetical Cyt Q733V0 113 30 49 109 4 114 3e-25 (Q733V0) Hypothetical pro Q9SRN6 244 54 68 72 1 110 3e-24 (Q9SRN6) T21P5.26 protein Q8LGK4 244 53 67 72 1 107 6e-23 (Q8LGK4) Hypothetical pro O22861 483 38 63 73 3 104 3e-22 (O22861) Hypothetical pro Q9UYC1 113 34 56 72 1 103 8e-22 (Q9UYC1) Hypothetical pro O58178 114 30 57 72 1 99 1e-20 (O58178) Hypothetical pro Q8U3J6 113 31 55 76 1 99 1e-20 (Q8U3J6) Hypothetical pro Q9KEN6 113 26 40 106 5 69 9e-12 (Q9KEN6) BH0816 protein Q88TE9 115 26 49 80 7 43 6e-04 (Q88TE9) Hypothetical pro --- --- PSI-BLAST ALIGNMENT
--- ------------------------------------------------------------ --- MAXHOM multiple sequence alignment --- ------------------------------------------------------------ --- --- MAXHOM ALIGNMENT HEADER: ABBREVIATIONS FOR SUMMARY --- ID : identifier of aligned (homologous) protein --- STRID : PDB identifier (only for known structures) --- IDE : percentage of pairwise sequence identity --- WSIM : percentage of weighted similarity --- LALI : number of residues aligned --- NGAP : number of insertions and deletions (indels) --- LGAP : number of residues in all indels --- LSEQ2 : length of aligned sequence --- ACCNUM : SwissProt accession number --- OMIM : OMIM (Online Mendelian Inheritance in Man) ID --- NAME : one-line description of aligned protein --- --- MAXHOM ALIGNMENT HEADER: SUMMARY ID STRID IDE WSIM LALI NGAP LGAP LSEQ2 ACCNUM NAME predict_h299 84 85 110 0 0 110 prot (#) default: single prote --- --- MAXHOM ALIGNMENT: IN MSF FORMAT
--- --- Version of database searched for alignment: --- SWISS-PROT release 41 (02/2003) with 122 564 proteins ---
Identities computed with respect to: (1) predict_h2990 Colored by: consensus/70% and property
1 [ . . . . : . . . . 1 ] 110 1 predict_h2990 100.0% MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY 2 predict_h299 83.6% MEWEMGLQXXXXXXXXXXXXXXXXXXYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY consensus/100% MEWEMGLQ..................YDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY consensus/90% MEWEMGLQ..................YDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY consensus/80% MEWEMGLQ..................YDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY consensus/70% MEWEMGLQ..................YDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY |
-------------------------------------------------------------------------------
Cysteines Bonding State and Connectivity Predictor
-------------------------------------------------------------------------------
Chain identifier:
MEWEMGLQXXXXXXXXXXXXXXXXXXYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY
The sequence contains no cysteine !!
-------------------------------------------------------------------------------
Please cite:
P. Frasconi, A. Passerini, and A. Vullo.
"A Two-Stage SVM Architecture for Predicting the Disulfide Bonding State of Cysteines"
Proc. IEEE Workshop on Neural Networks for Signal Processing, pp. 25-34, 2002.
A. Vullo and P. Frasconi.
"Disulfide Connectivity Prediction using Recursive Neural Networks and Evolutionary Information"
Bioinformatics, 20, 653-659, 2004.
Questions and comments are very appreciated.
Please, send email to: cystein@dsi.unifi.it
Created by members of the Machine Learning and
Neural Network Group, Universita' di Firenze
The server is hosted at the Department of Systems and
Computer Science (DSI), Faculty of Engineering,
Universita' di Firenze, Italy
-------------------------------------------------------------------------------
**************************************************************************** * * * PHD: Profile fed neural network systems from HeiDelberg * * ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ * * * * Prediction of: * * secondary structure, by PHDsec * * solvent accessibility, by PHDacc * * and helical transmembrane regions, by PHDhtm * * * * Author: * * Burkhard Rost * * EMBL, 69012 Heidelberg, Germany * * Internet: Rost@EMBL-Heidelberg.DE * * * * All rights reserved. * * * **************************************************************************** * * * The network systems are described in: * * * * PHDsec: B Rost & C Sander: JMB, 1993, 232, 584-599. * * B Rost & C Sander: Proteins, 1994, 19, 55-72. * * PHDacc: B Rost & C Sander: Proteins, 1994, 20, 216-226. * * PHDhtm: B Rost et al.: Prot. Science, 1995, 4, 521-533. * * * ****************************************************************************
| %A: 1.8 | %C: 0.0 | %D: 2.7 | %E: 18.2 | %F: 3.6 |
| %G: 8.2 | %H: 0.0 | %I: 8.2 | %K: 12.7 | %L: 9.1 |
| %M: 2.7 | %N: 1.8 | %P: 2.7 | %Q: 2.7 | %R: 8.2 |
| %S: 2.7 | %T: 0.0 | %V: 8.2 | %W: 0.9 | %Y: 5.5 |
| AA : | amino acid sequence |
| Rel_sec: | reliability index for PHDsec prediction (0=low to 9=high) Note: for the brief presentation strong predictions marked by '*' |
| SUB_sec: | subset of the PHDsec prediction, for all residues with an expected average accuracy > 82% (tables in header) NOTE: for this subset the following symbols are used: L: is loop (for which above ' ' is used) .: means that no prediction is made for this residue, as the reliability is: Rel < 5 |
| pH_sec: | 'probability' for assigning helix (1=high, 0=low) |
| pL_sec: | 'probability' for assigning neither helix, nor strand (1=high, 0=low) |
| PHD_htm: | PHD predicted membrane helix: M=helical transmembrane region, blank=non-membrane PHD = PHD: Profile network prediction HeiDelberg |
| pT_htm: | 'probability' for assigning transmembrane helix |
| pN_htm: | 'probability' for assigning globular region |
| phd_skip: | note: sequence stretches with less than 9 are not predicted, the symbol '*' is used! |
PHD results (brief)....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,....9....,....1 AA MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGV Rel_sec **************************************************************************************************** PHD_htm ....,....1 AA VAIEIEPLEY Rel_sec ********** PHD_htm
....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,....9....,....1 AA MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGV Rel_sec 9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999 SUB_sec PHD_htm ....,....1 AA VAIEIEPLEY Rel_sec 9999999999 SUB_sec PHD_htm
| Bottom - Summary - Details - PredictProtein |
PROF predictions for query |
SYNOPSIS of prediction for query |
| sec str type | H | E | L |
| % in protein | 30.91 | 30.00 | 39.09 |
| accessib type | b | e | sub...: | accessib type | b | e | |
| % in protein | 30.91 | 69.09 | ...set: | % in subset | 16.67 | 83.33 |
HEADER information |
| ali_orig | /home/ppuser/server/work/predict_h29929.hsspPsiFil |
| %A: 1.8 | %C: 0.0 | %D: 2.7 | %E: 18.2 | %F: 3.6 |
| %G: 8.2 | %H: 0.0 | %I: 8.2 | %K: 12.7 | %L: 9.1 |
| %M: 2.7 | %N: 1.8 | %P: 2.7 | %Q: 2.7 | %R: 8.2 |
| %S: 2.7 | %T: 0.0 | %V: 8.2 | %W: 0.9 | %Y: 5.5 |
| prof_fpar | acc=/home/ppuser/server/pub/prof/net/PROFboth_best.par |
| prof_nnet | acc=6 |
| AA : | amino acid sequence |
| OBS_sec: | observed secondary structure: H=helix, E=extended (sheet), blank=other (loop) |
| PROF_sec: | PROF predicted secondary structure: H=helix, E=extended (sheet), blank=other (loop) PROF = PROF: Profile network prediction HeiDelberg |
| Rel_sec: | reliability index for PROFsec prediction (0=low to 9=high) Note: for the brief presentation strong predictions marked by '*' |
| SUB_sec: | subset of the PROFsec prediction, for all residues with an expected average accuracy > 82% (tables in header) NOTE: for this subset the following symbols are used: L: is loop (for which above ' ' is used) .: means that no prediction is made for this residue, as the reliability is: Rel < 5 |
| pH_sec: | 'probability' for assigning helix (1=high, 0=low) |
| pE_sec: | 'probability' for assigning strand (1=high, 0=low) |
| pL_sec: | 'probability' for assigning neither helix, nor strand (1=high, 0=low) |
| O_2_acc: | observerd relative solvent accessibility (acc) in 2 states: b = 0-16%, e = 16-100%. |
| P_2_acc: | PROF predicted relative solvent accessibility (acc) in 2 states: b = 0-16%, e = 16-100%. |
| O_3_acc: | observerd relative solvent accessibility (acc) in 3 states: b = 0-9%, i = 9-36%, e = 36-100%. |
| P_3_acc: | PROF predicted relative solvent accessibility (acc) in 3 states: b = 0-9%, i = 9-36%, e = 36-100%. |
| OBS_acc: | observed relative solvent accessibility (acc) in 10 states: a value of n (=0-9) corresponds to a relative acc. of between n*n % and (n+1)*(n+1) % (e.g. for n=5: 16-25%). |
| PROF_acc: | PROF predicted relative solvent accessibility (acc) in 10 states: a value of n (=0-9) corresponds to a relative acc. of between n*n % and (n+1)*(n+1) % (e.g. for n=5: 16-25%). |
| Rel_acc: | reliability index for PROFacc prediction (0=low to 9=high) Note: for the brief presentation strong predictions marked by '*' |
| SUB_acc: | subset of the PROFacc prediction, for all residues with an expected average correlation > 0.69 (tables in header) NOTE: for this subset the following symbols are used: I: is intermediate (for which above ' ' is used) .: means that no prediction is made for this residue, as the reliability is: Rel < 4 |
| ali_orig: | input file |
| prof_fpar: | name of parameter file, used [w] |
| prof_nnet: | number of networks used for prediction [d] |
| prof_skip: | note: sequence stretches with less than 9 are not predicted, the symbol '*' is used! |
BODY with predictions for query |
PROF results (normal)....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,....9....,....10.1.,....1 AA MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY OBS_sec PROF_sec HHHHHHH EEEEEEHHHHH EEEE EEEEEEEEEEEE HHHHHHH HHHHHHHHHHH HHHHEE EEEEEEEEE Rel_sec 92002467117777523871577440025312347898688438445788765311012678763156200267865478888887641450120012315578775118 SUB_sec L.....LL..HHHHH..LL.EEE.....H.....LLLLEEE..L..EEEEEEE......HHHHH..LL....LLLLL.HHHHHHHHH...L.........EEEEEEE..L O_3_acc bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb P_3_acc ee e ebeee e beeeeee eb b eeeeee eee b beeeeb b beebe beebbeeee ee ee e beebbe b e beeeeeee bbbbb b e ee Rel_acc 26331134331174156332314242310223424422253351033344332033013445236633254125404314431333331223411151225594242166 SUB_acc .e.....e....ei.ee.....e.i.......e.ee...b..e.....bi.........bee..ee...ee..ee.e..ee...........e...e...bbbi.i..ee
....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,....9....,....10.1.,....1 AA MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIEEGIQVYRRFYDEEKEKKYGVVAIEIEPLEY pH_sec . ...... 1.0 pH_sec .... ..... ........ 0.9 pH_sec ..... . ..... ......... 0.8 pH_sec ...... .. ...... .......... 0.7 pH_sec ....... ... ....... .......... .. 0.6 pH_sec ....... .... ....... . ........... ... 0.5 pH_sec ......... ..... ........ ... ........... ..... 0.4 pH_sec ......... ...... ............ ... ............. ...... 0.3 pH_sec . ......... ........ ................... ....................... 0.2 -------------------------------------------------------------------------------------------------------------- pE_sec . .. . 1.0 pE_sec .. ... ..... .... 0.9 pE_sec .... .... ........ ....... 0.8 pE_sec ..... .... ......... ....... 0.7 pE_sec ..... .... .......... ......... 0.6 pE_sec .. ....... .... ............ . .......... 0.5 pE_sec .... ....... ..... ............ ............... 0.4 pE_sec ..... ........ .. ..... .............. . ............... 0.3 pE_sec ......... ......... ...... ..... .............. .... . ... ................ 0.2 -------------------------------------------------------------------------------------------------------------- pL_sec . . .. . 1.0 pL_sec . . .. .... . .... . 0.9 pL_sec . .. .. .... .. .. ..... . . 0.8 pL_sec . ... ... ..... ... .. ...... .. . . 0.7 pL_sec .. ..... .... ....... ... . ... ....... .. .. .. 0.6 pL_sec ......... .... . ....... ... .. ............. .... ... .. 0.5 pL_sec .......... ..... .. ........ ... . ... .............. ...... .... ... 0.4 pL_sec .......... ...... ..... ......... ...... ...... .............. .............. .... 0.3 pL_sec .......... ......................... ....... ......... ................ ................. ...... 0.2 -------------------------------------------------------------------------------------------------------------- OBS_acc 100% OBS_acc 81% OBS_acc 64% OBS_acc 49% OBS_acc 36% OBS_acc 25% OBS_acc 16% OBS_acc 9% OBS_acc 4% -------------------------------------------------------------------------------------------------------------- PROF_acc . ... . .. . 100% PROF_acc . . ... . ... . . . .. . .. .. 81% PROF_acc .. . . .. . ..... . .. ... .. . .. . .. .. . . . .. . .. 64% PROF_acc .. . . ... . ...... . ...... ... .... .. . .. .... .. .. . .. . . ....... . .. 49% PROF_acc .. . . ... .. ...... . . ....... ..... . .... . . .. .. .. .. .... .. ..... .. .. .. ....... . .. .. 36% PROF_acc .. . . .... .. ...... . . ....... ..... . .... . . .. .. .. .. .... .. ...... .. .. .. ....... . ..... 25% PROF_acc ...... ....... ........ . ............. . .... . . .. ..... .. .............. .. .. ... ........ . ..... 16% PROF_acc .............. ........ . ............. . .... . . .. ..... .. .............. .. .. ............ . ..... 9% PROF_acc .............. ........ . ............. . .... . . .. ..... .. .............. .. .. ............ . ..... 4% --------------------------------------------------------------------------------------------------------------
| Top - Summary - Details - PredictProtein |
--- --- GLOBE: prediction of protein globularity --- --- nexp = 76 (number of predicted exposed residues) --- nfit = 55 (number of expected exposed residues --- diff = 21.00 (difference nexp-nfit) --- =====> your protein may be globular, but it is not as compact as a domain --- --- --- GLOBE: further explanations preliminaryily in: --- http://cubic.bioc.columbia.edu/papers/1999_globe/paper.html --- --- END of GLOBE
Ambivalent Sequence Predictor (ASP v1.0) mmy Parameters: Window size : 5 Min mu dPr : 9 Z-score cutoff : -1.75 Mean dPr score=12.656, Standard deviation=3.194 Please note: ASP was designed to identify the location of conformational switches in amino acid sequences. It is NOT designed to predict whether a given sequence does or does not contain a switch. For best results, ASP should be used on sequences of length >150 amino acids with >10 sequence homologues in the SWISS-PROT data bank. ASP has been validated against a set of globular proteins and may not be generally applicable. Please see Young et al., Protein Science 8(9):1852-64. 1999. for details and for how best to interpret this output. We consider ASP to be experimental at this time, and would appreciate any feedback from our users.
END of results for file predict_h29929
| Links: | TOP |
|
|
|