BLASTP 2.2.9 [May-01-2004]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

RID: 1098134836-6034-168307442651.BLASTQ1

Query= 
         (162 letters)


Database: PDB protein database 
           18,695 sequences; 4,163,319 total letters

 
If you have any problems or questions with the results of this search 
please refer to the BLAST FAQs

Taxonomy reports

Related Structures

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|27065431|pdb|1LQM|H  Chain H, Escherichia Coli Uracil-Dna...    28   0.93  
gi|4558334|pdb|1UGH|I  Chain I, Crystal Structure Of Human U...    28   0.93  
gi|1431681|pdb|1UDI|I  Chain I, Mol_id: 1; Molecule: Uracil-...    28   0.93  

Alignments


>gi|27065431|pdb|1LQM|H   Chain H, Escherichia Coli Uracil-Dna Glycosylase Complex With
          Uracil- Dna Glycosylase Inhibitor Protein
 gi|27065429|pdb|1LQM|F   Chain F, Escherichia Coli Uracil-Dna Glycosylase Complex With
          Uracil- Dna Glycosylase Inhibitor Protein
 gi|27065427|pdb|1LQM|D   Chain D, Escherichia Coli Uracil-Dna Glycosylase Complex With
          Uracil- Dna Glycosylase Inhibitor Protein
 gi|27065425|pdb|1LQM|B   Chain B, Escherichia Coli Uracil-Dna Glycosylase Complex With
          Uracil- Dna Glycosylase Inhibitor Protein
 gi|27065415|pdb|1LQG|D   Chain D, Escherichia Coli Uracil-Dna Glycosylase Complex With
          Uracil- Dna Glycosylase Inhibitor Protein
 gi|27065414|pdb|1LQG|C   Chain C, Escherichia Coli Uracil-Dna Glycosylase Complex With
          Uracil- Dna Glycosylase Inhibitor Protein
 gi|4699674|pdb|2UUG|D   Chain D, Escherichia Coli Uracil-Dna Glycosylase:inhibitor
          Complex With H187d Mutant Udg And Wild-Type Ugi
 gi|4699673|pdb|2UUG|C   Chain C, Escherichia Coli Uracil-Dna Glycosylase:inhibitor
          Complex With H187d Mutant Udg And Wild-Type Ugi
 gi|4699668|pdb|1UUG|D   Chain D, Escherichia Coli Uracil-Dna Glycosylase:inhibitor
          Complex With Wild-Type Udg And Wild-Type Ugi
 gi|4699666|pdb|1UUG|B   Chain B, Escherichia Coli Uracil-Dna Glycosylase:inhibitor
          Complex With Wild-Type Udg And Wild-Type Ugi
 gi|5542228|pdb|1EUI|D   Chain D, Escherichia Coli Uracil-Dna Glycosylase Complex With
          Uracil-Dna Glycosylase Inhibitor Protein
 gi|5542227|pdb|1EUI|C   Chain C, Escherichia Coli Uracil-Dna Glycosylase Complex With
          Uracil-Dna Glycosylase Inhibitor Protein
 gi|4699670|pdb|2UGI|B   Chain B, Protein Mimicry Of Dna From Crystal Structures Of The
          Uracil Glycosylase Inhibitor Protein And Its Complex
          With Escherichia Coli Uracil-Dna Glycosylase
 gi|4699669|pdb|2UGI|A   Chain A, Protein Mimicry Of Dna From Crystal Structures Of The
          Uracil Glycosylase Inhibitor Protein And Its Complex
          With Escherichia Coli Uracil-Dna Glycosylase
 gi|4699664|pdb|1UGI|H   Chain H, Uracil-Dna Glycosylase Inhibitor Protein
 gi|4699663|pdb|1UGI|G   Chain G, Uracil-Dna Glycosylase Inhibitor Protein
 gi|4699662|pdb|1UGI|F   Chain F, Uracil-Dna Glycosylase Inhibitor Protein
 gi|4699661|pdb|1UGI|E   Chain E, Uracil-Dna Glycosylase Inhibitor Protein
 gi|4699660|pdb|1UGI|D   Chain D, Uracil-Dna Glycosylase Inhibitor Protein
 gi|4699659|pdb|1UGI|C   Chain C, Uracil-Dna Glycosylase Inhibitor Protein
 gi|4699658|pdb|1UGI|B   Chain B, Uracil-Dna Glycosylase Inhibitor Protein
 gi|4699657|pdb|1UGI|A   Chain A, Uracil-Dna Glycosylase Inhibitor Protein
          Length = 84

 Score = 27.7 bits (60), Expect = 0.93
 Identities = 13/43 (30%), Positives = 22/43 (51%)

Query: 56 LSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYL 98
          L  T Y + +  N+M+  S    Y    L I+ + GEN+++ L
Sbjct: 42 LVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML 84



>gi|4558334|pdb|1UGH|I   Chain I, Crystal Structure Of Human Uracil-Dna Glycosylase In
          Complex With A Protein Inhibitor: Protein Mimicry Of
          Dna
          Length = 82

 Score = 27.7 bits (60), Expect = 0.93
 Identities = 13/43 (30%), Positives = 22/43 (51%)

Query: 56 LSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYL 98
          L  T Y + +  N+M+  S    Y    L I+ + GEN+++ L
Sbjct: 40 LVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML 82



>gi|1431681|pdb|1UDI|I   Chain I, Mol_id: 1; Molecule: Uracil-Dna Glycosylase; Chain: E;
          Ec: 3.2.2.3; Mol_id: 2; Molecule: Uracil-Dna
          Glycosylase Inhibitor Protein; Chain: I; Synonym: Ugi
          Length = 83

 Score = 27.7 bits (60), Expect = 0.93
 Identities = 13/43 (30%), Positives = 22/43 (51%)

Query: 56 LSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYL 98
          L  T Y + +  N+M+  S    Y    L I+ + GEN+++ L
Sbjct: 41 LVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML 83






  Database: PDB protein database
    Posted date:  Oct 17, 2004 12:27 AM
  Number of letters in database: 4,163,319
  Number of sequences in database:  18,695
  
Lambda     K      H
   0.314    0.131    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 586,648
Number of Sequences: 18695
Number of extensions: 16855
Number of successful extensions: 18
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 16
Number of HSP's gapped (non-prelim): 2
length of query: 162
length of database: 4,163,319
effective HSP length: 83
effective length of query: 79
effective length of database: 2,611,634
effective search space: 206319086
effective search space used: 206319086
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 52 (24.6 bits)