CASP6 Target T0265
-
1. Protein Name
- 1wdo
-
2. Organism Name
- Sulfolobus tokadaii
-
3. Number of amino acids (approx)
- 109
-
4. Accession number
- NP_377872
-
5. Sequence Database
- Genbank
-
6. Amino acid sequence
-
MMKEKLESKKDEIRCCYKITDTDVAVLLKMVEIEKPITSEELADIFKLSKTTVENSLKKL
IELGLVVRTKTEGKKIGRPKYYYSISSNILEKIRNDLLNCAKRMELAAT
-
7. Additional information
-
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- -
- 10. Interpretable map?
- no
- 11. Estimated date of chain tracing completion
- 09/01/2004
- 12. Estimated date of public release of structure
- 10/2004
Related Files
Template Sequence file
Template PDB file