>gi|27573727|pdb|1KU9|BChain B, X-Ray Structure Of A Methanococcus Jannaschii Dna-Binding Protein: Implications For Antibiotic Resistance In Staphylococcus Aureus gi|27573726|pdb|1KU9|A
Chain A, X-Ray Structure Of A Methanococcus Jannaschii Dna-Binding Protein: Implications For Antibiotic Resistance In Staphylococcus Aureus Length = 152 Score = 38.5 bits (88), Expect = 3e-04 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 7/69 (10%) Query: 34 EKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTEGKKIGRPKYYYSI----SSNI 89 +KP+T ++ + K+SK V SLKKL ELG V + +G+ R YY ++ S Sbjct: 39 DKPLTISDIXEELKISKGNVSXSLKKLEELGFVRKVWIKGE---RKNYYEAVDGFSSIKD 95 Query: 90 LEKIRNDLL 98 + K ++DL+ Sbjct: 96 IAKRKHDLI 104
>gi|28373543|pdb|1LJ9|BChain B, The Crystal Structure Of The Transcriptional Regulator Slya gi|28373542|pdb|1LJ9|A
Chain A, The Crystal Structure Of The Transcriptional Regulator Slya Length = 144 Score = 30.8 bits (68), Expect = 0.056 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Query: 37 ITSEELADIFKLSKTTVENSLKKLIELGLVVRTK-TEGKKIGR 78 I E++A++ K+ +TT ++K+L E G + R + KKI R Sbjct: 44 IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKR 86
>gi|15988504|pdb|1H6P|BChain B, Dimeristion Domain From Human Trf2 gi|15988503|pdb|1H6P|A
Chain A, Dimeristion Domain From Human Trf2 Length = 203 Score = 30.0 bits (66), Expect = 0.095 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Query: 46 FKLSKTTVENSLKKLIELGLVVRTKT-EGKKIGRPKYYYSISSNILEKIRNDLLNCAKRM 104 F L++ VE+S K + E +++ K E +K + + +K+RNDLLN + Sbjct: 101 FTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREK 160 Query: 105 ELA 107 LA Sbjct: 161 NLA 163
>gi|46015340|pdb|1Q7B|DChain D, The Structure Of Betaketoacyl-[acp] Reductase From E. Coli In Complex With Nadp+ gi|46015339|pdb|1Q7B|C
Chain C, The Structure Of Betaketoacyl-[acp] Reductase From E. Coli In Complex With Nadp+ gi|46015338|pdb|1Q7B|B
Chain B, The Structure Of Betaketoacyl-[acp] Reductase From E. Coli In Complex With Nadp+ gi|46015337|pdb|1Q7B|A
Chain A, The Structure Of Betaketoacyl-[acp] Reductase From E. Coli In Complex With Nadp+ gi|13096193|pdb|1I01|H
Chain H, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. gi|13096192|pdb|1I01|G
Chain G, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. gi|13096191|pdb|1I01|F
Chain F, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. gi|13096190|pdb|1I01|E
Chain E, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. gi|13096189|pdb|1I01|D
Chain D, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. gi|13096188|pdb|1I01|C
Chain C, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. gi|13096187|pdb|1I01|B
Chain B, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. gi|13096186|pdb|1I01|A
Chain A, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. Length = 244 Score = 25.4 bits (54), Expect = 2.3 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Query: 26 VLLKMVEIE-KPITSEELADIFKLSKTTVENSLKK----LIELGLVVRTKTEG 73 +L++M + E I L+ +F+LSK + +KK +I +G VV T G Sbjct: 94 LLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNG 146
>gi|46015342|pdb|1Q7C|BChain B, The Structure Of Betaketoacyl-[acp] Reductase Y151f Mutant In Complex With Nadph Fragment gi|46015341|pdb|1Q7C|A
Chain A, The Structure Of Betaketoacyl-[acp] Reductase Y151f Mutant In Complex With Nadph Fragment Length = 244 Score = 25.4 bits (54), Expect = 2.3 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Query: 26 VLLKMVEIE-KPITSEELADIFKLSKTTVENSLKK----LIELGLVVRTKTEG 73 +L++M + E I L+ +F+LSK + +KK +I +G VV T G Sbjct: 94 LLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNG 146
>gi|2392137|pdb|1AHR|Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Score = 25.4 bits (54), Expect = 2.3 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Query: 1 MMKEKLESKKDEIRCCYKITDTDVAVLLKMVEIEKPITS--EELAD 44 MM K++ ++EIR +++ D D + E+ +T+ E+L D Sbjct: 71 MMARKMKDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTD 116
>gi|18655416|pdb|1I1G|BChain B, Crystal Structure Of The Lrp-Like Transcriptional Regulator From The Archaeon Pyrococcus Furiosus gi|18655415|pdb|1I1G|A
Chain A, Crystal Structure Of The Lrp-Like Transcriptional Regulator From The Archaeon Pyrococcus Furiosus Length = 141 Score = 24.6 bits (52), Expect = 4.0 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query: 26 VLLKMVEIEKPITSEELADIFKLSKTTVENSLKKLIELGLV--VRTKTEGKKIG 77 ++L+++E + E+A +S+T V +K L E G++ K KK+G Sbjct: 8 IILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGYTIKINPKKLG 61
>gi|4699707|pdb|1A6E|AChain A, Thermosome - Mg-Adp-Alf3 Complex gi|4699705|pdb|1A6D|A
Chain A, Thermosome From T. Acidophilum Length = 545 Score = 24.6 bits (52), Expect = 4.0 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Query: 3 KEKLESKKDEIRCCYKITDTDVAVLLKMVEIEKPITSEELADIFKLSK--TTVENSLKKL 60 KEK+ SK ++ KI D A+ +K EIE + +++D K+ N+ K++ Sbjct: 220 KEKVHSKMPDVVKNAKIALIDSALEIKKTEIEAKV---QISDPSKIQDFLNQETNTFKQM 276 Query: 61 IE 62 +E Sbjct: 277 VE 278
>gi|2781187|pdb|1ASX|Apical Domain Of The Chaperonin From Thermoplasma Acidophilum gi|2781186|pdb|1ASS|
Apical Domain Of The Chaperonin From Thermoplasma Acidophilum Length = 159 Score = 24.6 bits (52), Expect = 4.0 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Query: 3 KEKLESKKDEIRCCYKITDTDVAVLLKMVEIEKPITSEELADIFKLSK--TTVENSLKKL 60 KEK+ SK ++ KI D A+ +K EIE + +++D K+ N+ K++ Sbjct: 8 KEKVHSKMPDVVKNAKIALIDSALEIKKTEIEAKV---QISDPSKIQDFLNQETNTFKQM 64 Query: 61 IE 62 +E Sbjct: 65 VE 66
>gi|49259125|pdb|1SQL|PChain P, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259124|pdb|1SQL|O
Chain O, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259123|pdb|1SQL|N
Chain N, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259122|pdb|1SQL|M
Chain M, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259121|pdb|1SQL|L
Chain L, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259120|pdb|1SQL|K
Chain K, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259119|pdb|1SQL|J
Chain J, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259118|pdb|1SQL|I
Chain I, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259117|pdb|1SQL|H
Chain H, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259116|pdb|1SQL|G
Chain G, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259115|pdb|1SQL|F
Chain F, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259114|pdb|1SQL|E
Chain E, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259113|pdb|1SQL|D
Chain D, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259112|pdb|1SQL|C
Chain C, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259111|pdb|1SQL|B
Chain B, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine gi|49259110|pdb|1SQL|A
Chain A, Crystal Structure Of 7,8-Dihydroneopterin Aldolase In Complex With Guanine Length = 146 Score = 23.9 bits (50), Expect = 6.8 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 19 ITDTDVAVLLKMV-EIEKPITSEELADIFKLSKTTVENSLKKLIE 62 + D D V LK E + + DIF L+K VE S + L+E Sbjct: 49 LVDIDAWVSLKKAGESDNLEDTISYVDIFSLAKEIVEGSPRNLLE 93
>gi|52696194|pdb|1VLF|XChain X, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene gi|52696192|pdb|1VLF|V
Chain V, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene gi|52696190|pdb|1VLF|T
Chain T, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene gi|52696188|pdb|1VLF|R
Chain R, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene gi|52696186|pdb|1VLF|P
Chain P, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene gi|52696184|pdb|1VLF|N
Chain N, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene gi|52696182|pdb|1VLE|X
Chain X, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Pyrogallol gi|52696180|pdb|1VLE|V
Chain V, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Pyrogallol gi|52696178|pdb|1VLE|T
Chain T, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Pyrogallol gi|52696176|pdb|1VLE|R
Chain R, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Pyrogallol gi|52696174|pdb|1VLE|P
Chain P, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Pyrogallol gi|52696172|pdb|1VLE|N
Chain N, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Pyrogallol gi|52696170|pdb|1VLD|X
Chain X, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici gi|52696168|pdb|1VLD|V
Chain V, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici gi|52696166|pdb|1VLD|T
Chain T, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici gi|52696164|pdb|1VLD|R
Chain R, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici gi|52696162|pdb|1VLD|P
Chain P, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici gi|52696160|pdb|1VLD|N
Chain N, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici gi|52695788|pdb|1TI6|L
Chain L, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene gi|52695786|pdb|1TI6|J
Chain J, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene gi|52695784|pdb|1TI6|H
Chain H, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene gi|52695782|pdb|1TI6|F
Chain F, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene gi|52695780|pdb|1TI6|D
Chain D, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene gi|52695778|pdb|1TI6|B
Chain B, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene gi|52695776|pdb|1TI4|L
Chain L, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Pyrogallol gi|52695774|pdb|1TI4|J
Chain J, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Pyrogallol gi|52695772|pdb|1TI4|H
Chain H, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Pyrogallol gi|52695770|pdb|1TI4|F
Chain F, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Pyrogallol gi|52695768|pdb|1TI4|D
Chain D, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Pyrogallol gi|52695766|pdb|1TI4|B
Chain B, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Complexed With Pyrogallol gi|52695764|pdb|1TI2|L
Chain L, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici gi|52695762|pdb|1TI2|J
Chain J, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici gi|52695760|pdb|1TI2|H
Chain H, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici gi|52695758|pdb|1TI2|F
Chain F, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici gi|52695756|pdb|1TI2|D
Chain D, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici gi|52695754|pdb|1TI2|B
Chain B, Crystal Structure Of Pyrogallol-Phloroglucinol Transhydroxylase From Pelobacter Acidigallici Length = 274 Score = 23.9 bits (50), Expect = 6.8 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Query: 45 IFKLSKTTVENSLKKLIELGLVVRTKTEGKKIGRPKYYY 83 +++ KTT E KK+ E GL V G K P+ YY Sbjct: 153 VYEFLKTTPEAMAKKVEEEGLEVIKPELGTK---PRVYY 188
>gi|42543274|pdb|1P9B|AChain A, Structure Of Fully Ligated Adenylosuccinate Synthetase From Plasmodium Falciparum Length = 442 Score = 23.9 bits (50), Expect = 6.8 Identities = 14/52 (26%), Positives = 22/52 (42%) Query: 11 DEIRCCYKITDTDVAVLLKMVEIEKPITSEELADIFKLSKTTVENSLKKLIE 62 D + Y IT+ D L + + + D+ T +EN+ K LIE Sbjct: 178 DHLMDLYNITEYDKEKELNLFYNYHIKLRDRIVDVISFMNTNLENNKKVLIE 229
>gi|6137387|pdb|3BTA|AChain A, Crystal Structure Of Botulinum Neurotoxin Serotype A Length = 1295 Score = 23.9 bits (50), Expect = 6.8 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 36 PITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTEGKKIGRPKYYYSISSN 88 PI ++ +F L + +E LK I + + I PKY+ SIS N Sbjct: 907 PIDKNQI-QLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLN 958
>gi|231093|pdb|4TNC|Troponin C Length = 162 Score = 23.5 bits (49), Expect = 8.9 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 24 VAVLLKMVEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTE 72 V ++ +M E K + EELAD F++ + + + ELG ++R E Sbjct: 80 VMMVRQMKEDAKGKSEEELADCFRIFDKNADGFI-DIEELGEILRATGE 127
Database: PDB protein database
Posted date: Nov 3, 2004 12:50 AM
Number of letters in database: 4,163,319
Number of sequences in database: 18,695
Lambda K H
0.315 0.132 0.350
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 365,986
Number of Sequences: 18695
Number of extensions: 11934
Number of successful extensions: 30
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 29
Number of HSP's gapped (non-prelim): 5
length of query: 109
length of database: 4,163,319
effective HSP length: 72
effective length of query: 37
effective length of database: 2,817,279
effective search space: 104239323
effective search space used: 104239323
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 49 (23.5 bits)