>gi|17943077|pdb|1JJI|AChain A, The Crystal Structure Of A Hyper-Thermophilic Carboxylesterase From The Archaeon Archaeoglobus Fulgidus gi|17943078|pdb|1JJI|B
Chain B, The Crystal Structure Of A Hyper-Thermophilic Carboxylesterase From The Archaeon Archaeoglobus Fulgidus gi|17943079|pdb|1JJI|C
Chain C, The Crystal Structure Of A Hyper-Thermophilic Carboxylesterase From The Archaeon Archaeoglobus Fulgidus gi|17943080|pdb|1JJI|D
Chain D, The Crystal Structure Of A Hyper-Thermophilic Carboxylesterase From The Archaeon Archaeoglobus Fulgidus Length = 311 Score = 65.5 bits (147), Expect = 5e-11 Identities = 42/103 (40%), Positives = 61/103 (59%), Gaps = 25/103 (24%) Query: 81 PDSPATLFYLHGGGFILGNLDTHD----RIMRLLASYSQCTVIGIDYTLSPEARFPQAIE 136 PDSP ++Y HGGGF++ ++++HD RI RL S TV+ +DY L+PE +FP A+ Sbjct: 77 PDSPVLVYY-HGGGFVICSIESHDALCRRIARL----SNSTVVSVDYRLAPEHKFPAAVY 131 Query: 137 EIVAACCY-------FHQQAEDYQINMSRIGF-AGDSAGAMLA 171 + CY + AE+ +I+ S+I F GDSAG LA Sbjct: 132 D-----CYDATKWVA--ENAEELRIDPSKI-FVGGDSAGGNLA 166
>gi|11513478|pdb|1EVQ|AChain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius Length = 310 Score = 58.3 bits (130), Expect = 8e-09 Identities = 37/95 (38%), Positives = 58/95 (61%), Gaps = 15/95 (15%) Query: 84 PATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEE------ 137 PA ++Y HGGG+++G+L+THD + R+LA + V +DY L+PE +FP A+E+ Sbjct: 75 PALVYY-HGGGWVVGDLETHDPVCRVLAKDGRAVVFSVDYRLAPEHKFPAAVEDAYDALQ 133 Query: 138 -IVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLA 171 I ++A D+ ++ +RI GDSAG LA Sbjct: 134 WIA-------ERAADFHLDPARIAVGGDSAGGNLA 161
Score = 25.2 bits (52), Expect = 71
Identities = 8/13 (61%), Positives = 11/13 (84%)
Query: 252 PPCFIAGAEFDPL 264
PP +IA A++DPL
Sbjct: 242 PPAYIATAQYDPL 254
>gi|28373559|pdb|1LZL|AChain A, Bacterial Heroin Esterase Length = 323 Score = 32.5 bits (69), Expect = 0.48 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 10/56 (17%) Query: 121 IDYTLSPEARFPQAIEEIVAACCY-----FHQQAEDYQINMSRIGFAGDSAGAMLA 171 ++Y L+PE FP + + CY H AE+ I+ SRI G SAG LA Sbjct: 116 VEYRLAPETTFPGPVND-----CYAALLYIHAHAEELGIDPSRIAVGGQSAGGGLA 166
Score = 18.5 bits (36), Expect = 7867
Identities = 5/5 (100%), Positives = 5/5 (100%)
Query: 167 GAMLA 171
GAMLA
Sbjct: 38 GAMLA 42
Score = 17.6 bits (34), Expect = 14164
Identities = 4/4 (100%), Positives = 4/4 (100%)
Query: 191 VLLW 194
VLLW
Sbjct: 81 VLLW 84
>gi|28373558|pdb|1LZK|AChain A, Bacterial Heroin Esterase Complex With Transition State Analog Dimethylarsenic Acid Length = 323 Score = 32.5 bits (69), Expect = 0.48 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 10/56 (17%) Query: 121 IDYTLSPEARFPQAIEEIVAACCY-----FHQQAEDYQINMSRIGFAGDSAGAMLA 171 ++Y L+PE FP + + CY H AE+ I+ SRI G SAG LA Sbjct: 116 VEYRLAPETTFPGPVND-----CYAALLYIHAHAEELGIDPSRIAVGGQSAGGGLA 166
Score = 17.6 bits (34), Expect = 14164
Identities = 4/4 (100%), Positives = 4/4 (100%)
Query: 191 VLLW 194
VLLW
Sbjct: 81 VLLW 84
>gi|34809670|pdb|1P7T|BChain B, Structure Of Escherichia Coli Malate Synthase G:pyruvate:acetyl-Coenzyme A Abortive Ternary Complex At 1.95 Angstrom Resolution Length = 731 Score = 31.2 bits (66), Expect = 1.2 Identities = 10/13 (76%), Positives = 11/13 (84%), Gaps = 2/13 (15%) Query: 259 AEFDPLLDDSRLL 271 AEF+PLLDD LL Sbjct: 567 AEFEPLLDD--LL 577
>gi|34809669|pdb|1P7T|AChain A, Structure Of Escherichia Coli Malate Synthase G:pyruvate:acetyl-Coenzyme A Abortive Ternary Complex At 1.95 Angstrom Resolution Length = 731 Score = 31.2 bits (66), Expect = 1.2 Identities = 10/13 (76%), Positives = 11/13 (84%), Gaps = 2/13 (15%) Query: 259 AEFDPLLDDSRLL 271 AEF+PLLDD LL Sbjct: 567 AEFEPLLDD--LL 577
>gi|6573631|pdb|1D8C|AChain A, Malate Synthase G Complexed With Magnesium And Glyoxylate Length = 723 Score = 31.2 bits (66), Expect = 1.2 Identities = 10/13 (76%), Positives = 11/13 (84%), Gaps = 2/13 (15%) Query: 259 AEFDPLLDDSRLL 271 AEF+PLLDD LL Sbjct: 567 AEFEPLLDD--LL 577
>gi|13399462|pdb|1FP1|DChain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 Score = 31.2 bits (66), Expect = 1.2 Identities = 9/11 (81%), Positives = 11/11 (100%) Query: 104 DRIMRLLASYS 114 DR++RLLASYS Sbjct: 86 DRMLRLLASYS 96
>gi|13399464|pdb|1FPQ|AChain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O-Methyltransferase Length = 372 Score = 29.5 bits (62), Expect = 3.8 Identities = 9/11 (81%), Positives = 10/11 (90%) Query: 104 DRIMRLLASYS 114 DR +RLLASYS Sbjct: 86 DRXLRLLASYS 96
>gi|230844|pdb|3DPA|PapD Length = 218 Score = 29.1 bits (61), Expect = 5.1 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 5/20 (25%) Query: 234 DRESPYYCLFNNDLTREVPP 253 DRES +Y FN L RE+PP Sbjct: 81 DRESLFY--FN--L-REIPP 95
>gi|5822320|pdb|1QPX|AChain A, Crystal Structures Of Self-Capping Papd Chaperone Homodimers gi|5822321|pdb|1QPX|B
Chain B, Crystal Structures Of Self-Capping Papd Chaperone Homodimers Length = 218 Score = 29.1 bits (61), Expect = 5.1 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 5/20 (25%) Query: 234 DRESPYYCLFNNDLTREVPP 253 DRES +Y FN L RE+PP Sbjct: 81 DRESLFY--FN--L-REIPP 95
>gi|27574025|pdb|1N0L|AChain A, Crystal Structure Of The Papd Chaperone (C-Terminally 6x Histidine-Tagged) Bound To The Pape Pilus Subunit (N- Terminal-Deleted) From Uropathogenic E. Coli gi|27574027|pdb|1N0L|C
Chain C, Crystal Structure Of The Papd Chaperone (C-Terminally 6x Histidine-Tagged) Bound To The Pape Pilus Subunit (N- Terminal-Deleted) From Uropathogenic E. Coli Length = 224 Score = 29.1 bits (61), Expect = 5.1 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 5/20 (25%) Query: 234 DRESPYYCLFNNDLTREVPP 253 DRES +Y FN L RE+PP Sbjct: 81 DRESLFY--FN--L-REIPP 95
>gi|5822318|pdb|1QPP|AChain A, Crystal Structures Of Self Capping Papd Chaperone Homodimers gi|5822319|pdb|1QPP|B
Chain B, Crystal Structures Of Self Capping Papd Chaperone Homodimers Length = 218 Score = 29.1 bits (61), Expect = 5.1 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 5/20 (25%) Query: 234 DRESPYYCLFNNDLTREVPP 253 DRES +Y FN L RE+PP Sbjct: 81 DRESLFY--FN--L-REIPP 95
>gi|6137749|pdb|1PDK|AChain A, Papd-Papk Chaperone-Pilus Subunit Complex From E.Coli P Pilus Length = 218 Score = 29.1 bits (61), Expect = 5.1 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 5/20 (25%) Query: 234 DRESPYYCLFNNDLTREVPP 253 DRES +Y FN L RE+PP Sbjct: 81 DRESLFY--FN--L-REIPP 95
>gi|21730240|pdb|1GVE|AChain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 Score = 27.8 bits (58), Expect = 12 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 7/24 (29%) Query: 71 QVET---RLFCPQPDSPATLFYLH 91 Q+ET RL CP+ D LFYLH Sbjct: 90 QLETSLKRLQCPRVD----LFYLH 109
Score = 18.9 bits (37), Expect = 5863
Identities = 6/7 (85%), Positives = 6/7 (85%)
Query: 71 QVETRLF 77
QVET LF
Sbjct: 174 QVETELF 180
Score = 17.2 bits (33), Expect = 19004
Identities = 4/5 (80%), Positives = 5/5 (100%)
Query: 127 PEARF 131
PE+RF
Sbjct: 215 PESRF 219
>gi|21730241|pdb|1GVE|BChain B, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 Score = 27.8 bits (58), Expect = 12 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 7/24 (29%) Query: 71 QVET---RLFCPQPDSPATLFYLH 91 Q+ET RL CP+ D LFYLH Sbjct: 90 QLETSLKRLQCPRVD----LFYLH 109
Score = 18.9 bits (37), Expect = 5863
Identities = 6/7 (85%), Positives = 6/7 (85%)
Query: 71 QVETRLF 77
QVET LF
Sbjct: 174 QVETELF 180
Score = 17.2 bits (33), Expect = 19004
Identities = 4/5 (80%), Positives = 5/5 (100%)
Query: 127 PEARF 131
PE+RF
Sbjct: 215 PESRF 219
>gi|30749782|pdb|1NXQ|AChain A, Crystal Structure Of R-Alcohol Dehydrogenase (Radh) (Apoenyzme) From Lactobacillus Brevis Length = 251 Score = 27.4 bits (57), Expect = 16 Identities = 12/17 (70%), Positives = 12/17 (70%), Gaps = 2/17 (11%) Query: 154 INMSRI-GFAGD-SAGA 168 INMS I GF GD S GA Sbjct: 138 INMSSIEGFVGDPSLGA 154
>gi|3318911|pdb|1A7L|AChain A, Dominant B-Cell Epitope From The Pres2 Region Of Hepatitis B Virus In The Form Of An Inserted Peptide Segment In Maltodextrin-Binding Protein gi|3318912|pdb|1A7L|B
Chain B, Dominant B-Cell Epitope From The Pres2 Region Of Hepatitis B Virus In The Form Of An Inserted Peptide Segment In Maltodextrin-Binding Protein gi|3318913|pdb|1A7L|C
Chain C, Dominant B-Cell Epitope From The Pres2 Region Of Hepatitis B Virus In The Form Of An Inserted Peptide Segment In Maltodextrin-Binding Protein Length = 389 Score = 26.9 bits (56), Expect = 22 Identities = 8/11 (72%), Positives = 10/11 (90%) Query: 303 TADEALRDGAQ 313 T DEAL+DG+Q Sbjct: 356 TVDEALKDGSQ 366
>gi|2914251|pdb|1NFD|EChain E, An Alpha-Beta T Cell Receptor (Tcr) Heterodimer In Complex With An Anti-Tcr Fab Fragment Derived From A Mitogenic Antibody gi|2914253|pdb|1NFD|G
Chain G, An Alpha-Beta T Cell Receptor (Tcr) Heterodimer In Complex With An Anti-Tcr Fab Fragment Derived From A Mitogenic Antibody Length = 212 Score = 26.5 bits (55), Expect = 30 Identities = 9/16 (56%), Positives = 10/16 (62%), Gaps = 4/16 (25%) Query: 236 ESPYYCLF----NNDL 247 E+ YYCL NNDL Sbjct: 81 EAAYYCLSSYGDNNDL 96
>gi|1311154|pdb|1CWP|AChain A, Bromovirus Mol_id: 1; Molecule: Cowpea Chlorotic Mottle Virus; Chain: A, B, C; Synonym: Ccmv; Mol_id: 2; Molecule: Rna (5'-(ApUpApU)-3'); Chain: D, F; Mol_id: 3; Molecule: Rna (5'-(ApU)-3'); Chain: E gi|1311155|pdb|1CWP|B
Chain B, Bromovirus Mol_id: 1; Molecule: Cowpea Chlorotic Mottle Virus; Chain: A, B, C; Synonym: Ccmv; Mol_id: 2; Molecule: Rna (5'-(ApUpApU)-3'); Chain: D, F; Mol_id: 3; Molecule: Rna (5'-(ApU)-3'); Chain: E gi|1311156|pdb|1CWP|C
Chain C, Bromovirus Mol_id: 1; Molecule: Cowpea Chlorotic Mottle Virus; Chain: A, B, C; Synonym: Ccmv; Mol_id: 2; Molecule: Rna (5'-(ApUpApU)-3'); Chain: D, F; Mol_id: 3; Molecule: Rna (5'-(ApU)-3'); Chain: E Length = 190 Score = 26.5 bits (55), Expect = 30 Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 3/19 (15%) Query: 179 RDKQIDCGKVAGVLLWYGL 197 R+KQ+ KV VLLW GL Sbjct: 82 RNKQL---KVGRVLLWLGL 97
>gi|15826443|pdb|1E4I|AChain A, 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE Complex Of The Beta-Glucosidase From Bacillus Polymyxa Length = 447 Score = 26.1 bits (54), Expect = 40 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 7/26 (26%) Query: 119 IGID-YTLS-----PEARFPQAIEEI 138 IGI+ Y++S PEA F Q+ EEI Sbjct: 290 IGINYYSMSVNRFNPEAGFLQS-EEI 314
>gi|6573453|pdb|1B0U|AChain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Score = 26.1 bits (54), Expect = 40 Identities = 8/12 (66%), Positives = 9/12 (75%) Query: 1 MKPENKLPVLDL 12 M ENKL V+DL Sbjct: 1 MMSENKLHVIDL 12
Score = 17.2 bits (33), Expect = 19004
Identities = 5/7 (71%), Positives = 6/7 (85%)
Query: 105 RIMRLLA 111
RIM+ LA
Sbjct: 194 RIMQQLA 200
>gi|3114332|pdb|1BGA|AChain A, Beta-Glucosidase A From Bacillus Polymyxa gi|3114333|pdb|1BGA|B
Chain B, Beta-Glucosidase A From Bacillus Polymyxa gi|3114334|pdb|1BGA|C
Chain C, Beta-Glucosidase A From Bacillus Polymyxa gi|3114335|pdb|1BGA|D
Chain D, Beta-Glucosidase A From Bacillus Polymyxa Length = 447 Score = 26.1 bits (54), Expect = 40 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 7/26 (26%) Query: 119 IGID-YTLS-----PEARFPQAIEEI 138 IGI+ Y++S PEA F Q+ EEI Sbjct: 290 IGINYYSMSVNRFNPEAGFLQS-EEI 314
>gi|4930140|pdb|1TR1|AChain A, Crystal Structure Of E96k Mutated Beta-Glucosidase A From Bacillus Polymyxa, An Enzyme With Increased Thermoresistance gi|4930141|pdb|1TR1|B
Chain B, Crystal Structure Of E96k Mutated Beta-Glucosidase A From Bacillus Polymyxa, An Enzyme With Increased Thermoresistance gi|4930142|pdb|1TR1|C
Chain C, Crystal Structure Of E96k Mutated Beta-Glucosidase A From Bacillus Polymyxa, An Enzyme With Increased Thermoresistance gi|4930143|pdb|1TR1|D
Chain D, Crystal Structure Of E96k Mutated Beta-Glucosidase A From Bacillus Polymyxa, An Enzyme With Increased Thermoresistance Length = 447 Score = 26.1 bits (54), Expect = 40 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 7/26 (26%) Query: 119 IGID-YTLS-----PEARFPQAIEEI 138 IGI+ Y++S PEA F Q+ EEI Sbjct: 290 IGINYYSMSVNRFNPEAGFLQS-EEI 314
>gi|20663773|pdb|1H6F|AChain A, Human Tbx3, A Transcription Factor Responsible For Ulnar-Mammary Syndrome , Bound To A Palindromic Dna Site gi|20663774|pdb|1H6F|B
Chain B, Human Tbx3, A Transcription Factor Responsible For Ulnar-Mammary Syndrome , Bound To A Palindromic Dna Site Length = 193 Score = 26.1 bits (54), Expect = 40 Identities = 11/31 (35%), Positives = 12/31 (38%), Gaps = 15/31 (48%) Query: 56 PEMATRAYMVPTKYGQVETRLFCPQPDSPAT 86 PEM R Y+ PDSPAT Sbjct: 80 PEMPKRMYI---------------HPDSPAT 95
>gi|3212498|pdb|1BGG|AChain A, Glucosidase A From Bacillus Polymyxa Complexed With Gluconate gi|3212499|pdb|1BGG|B
Chain B, Glucosidase A From Bacillus Polymyxa Complexed With Gluconate gi|3212500|pdb|1BGG|C
Chain C, Glucosidase A From Bacillus Polymyxa Complexed With Gluconate gi|3212501|pdb|1BGG|D
Chain D, Glucosidase A From Bacillus Polymyxa Complexed With Gluconate Length = 448 Score = 26.1 bits (54), Expect = 40 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 7/26 (26%) Query: 119 IGID-YTLS-----PEARFPQAIEEI 138 IGI+ Y++S PEA F Q+ EEI Sbjct: 291 IGINYYSMSVNRFNPEAGFLQS-EEI 315
>gi|11513492|pdb|1F16|AChain A, Solution Structure Of A Pro-Apoptotic Protein Bax Length = 192 Score = 25.7 bits (53), Expect = 53 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 9/22 (40%) Query: 200 LRDSVTRRLLG-----GVWDGL 216 LR+ RLLG G WDGL Sbjct: 144 LRE----RLLGWIQDQGGWDGL 161
Score = 17.2 bits (33), Expect = 19004
Identities = 5/5 (100%), Positives = 5/5 (100%)
Query: 188 VAGVL 192
VAGVL
Sbjct: 177 VAGVL 181
>gi|34810965|pdb|1NN7|AChain A, Crystal Structure Of The Tetramerization Domain Of The Shal Voltage-Gated Potassium Channel Length = 105 Score = 25.2 bits (52), Expect = 71 Identities = 8/18 (44%), Positives = 10/18 (55%), Gaps = 5/18 (27%) Query: 135 IEEIVAACCYFHQQAEDY 152 I EI+ CCY E+Y Sbjct: 84 IPEIIGDCCY-----EEY 96
>gi|17943045|pdb|1K32|AChain A, Crystal Structure Of The Tricorn Protease gi|17943046|pdb|1K32|B
Chain B, Crystal Structure Of The Tricorn Protease gi|17943047|pdb|1K32|C
Chain C, Crystal Structure Of The Tricorn Protease gi|17943048|pdb|1K32|D
Chain D, Crystal Structure Of The Tricorn Protease gi|17943049|pdb|1K32|E
Chain E, Crystal Structure Of The Tricorn Protease gi|17943050|pdb|1K32|F
Chain F, Crystal Structure Of The Tricorn Protease Length = 1045 Score = 25.2 bits (52), Expect = 71 Identities = 6/7 (85%), Positives = 7/7 (100%) Query: 221 LQMYEEA 227 LQMY+EA Sbjct: 661 LQMYDEA 667
Score = 18.0 bits (35), Expect = 10556
Identities = 4/5 (80%), Positives = 5/5 (100%)
Query: 282 CEFKL 286
C+FKL
Sbjct: 741 CDFKL 745
>gi|14719573|pdb|1IQ3|AChain A, Solution Structure Of The Eps15 Homology Domain Of A Human Pob1 Length = 110 Score = 25.2 bits (52), Expect = 71 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 9/26 (34%) Query: 24 LQ-----PDLPPWPATGTIAEQRQYY 44 LQ PD PW T EQR+YY Sbjct: 3 LQDNSSYPD-EPWRIT---EEQREYY 24
>gi|20149959|pdb|1GV0|AChain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases gi|20149960|pdb|1GV0|B
Chain B, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 Score = 25.2 bits (52), Expect = 71 Identities = 8/9 (88%), Positives = 8/9 (88%) Query: 8 PVLDLISAE 16 PV DLISAE Sbjct: 191 PVADLISAE 199
>gi|20150596|pdb|1JYL|AChain A, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) gi|20150597|pdb|1JYL|B
Chain B, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) gi|20150598|pdb|1JYL|C
Chain C, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) gi|20150599|pdb|1JYL|D
Chain D, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) Length = 254 Score = 25.2 bits (52), Expect = 71 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 15/33 (45%) Query: 225 EEAYLSN----DADRESPYYCLFNN----DLTR 249 EE L+N DAD Y LF N DLTR Sbjct: 116 EE--LANSYVIDAD----NY-LFKNMFRNDLTR 141
>gi|20150595|pdb|1JYK|AChain A, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) Length = 254 Score = 25.2 bits (52), Expect = 71 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 15/33 (45%) Query: 225 EEAYLSN----DADRESPYYCLFNN----DLTR 249 EE L+N DAD Y LF N DLTR Sbjct: 116 EE--LANSYVIDAD----NY-LFKNXFRNDLTR 141
>gi|15826201|pdb|1FI6|AChain A, Solution Structure Of The Reps1 Eh Domain Length = 92 Score = 25.2 bits (52), Expect = 71 Identities = 6/6 (100%), Positives = 6/6 (100%) Query: 39 EQRQYY 44 EQRQYY Sbjct: 6 EQRQYY 11
Score = 20.2 bits (40), Expect = 2427
Identities = 7/11 (63%), Positives = 8/11 (72%), Gaps = 3/11 (27%)
Query: 21 VN---TLQPDL 28
VN T+QPDL
Sbjct: 12 VNQFKTIQPDL 22
>gi|14277739|pdb|1HYN|PChain P, Crystal Structure Of The Cytoplasmic Domain Of Human Erythrocyte Band-3 Protein gi|14277740|pdb|1HYN|Q
Chain Q, Crystal Structure Of The Cytoplasmic Domain Of Human Erythrocyte Band-3 Protein gi|14277741|pdb|1HYN|R
Chain R, Crystal Structure Of The Cytoplasmic Domain Of Human Erythrocyte Band-3 Protein gi|14277742|pdb|1HYN|S
Chain S, Crystal Structure Of The Cytoplasmic Domain Of Human Erythrocyte Band-3 Protein Length = 379 Score = 25.2 bits (52), Expect = 71 Identities = 12/33 (36%), Positives = 13/33 (39%), Gaps = 18/33 (54%) Query: 73 ETRLFCPQ------------------PDSPATL 87 ET+LFC Q PDS ATL Sbjct: 196 ETQLFCEQGDGGTEGHSPSGILEKIPPDSEATL 228
Score = 17.2 bits (33), Expect = 19004
Identities = 4/4 (100%), Positives = 4/4 (100%)
Query: 121 IDYT 124
IDYT
Sbjct: 276 IDYT 279
>gi|27574089|pdb|1N6D|AChain A, Tricorn Protease In Complex With Tetrapeptide Chloromethyl Ketone Derivative gi|27574091|pdb|1N6D|B
Chain B, Tricorn Protease In Complex With Tetrapeptide Chloromethyl Ketone Derivative gi|27574093|pdb|1N6D|C
Chain C, Tricorn Protease In Complex With Tetrapeptide Chloromethyl Ketone Derivative gi|27574095|pdb|1N6D|D
Chain D, Tricorn Protease In Complex With Tetrapeptide Chloromethyl Ketone Derivative gi|27574097|pdb|1N6D|E
Chain E, Tricorn Protease In Complex With Tetrapeptide Chloromethyl Ketone Derivative gi|27574099|pdb|1N6D|F
Chain F, Tricorn Protease In Complex With Tetrapeptide Chloromethyl Ketone Derivative gi|27574101|pdb|1N6E|A
Chain A, Tricorn Protease In Complex With A Tridecapeptide Chloromethyl Ketone Derivative gi|27574103|pdb|1N6E|C
Chain C, Tricorn Protease In Complex With A Tridecapeptide Chloromethyl Ketone Derivative gi|27574105|pdb|1N6E|E
Chain E, Tricorn Protease In Complex With A Tridecapeptide Chloromethyl Ketone Derivative gi|27574107|pdb|1N6E|G
Chain G, Tricorn Protease In Complex With A Tridecapeptide Chloromethyl Ketone Derivative gi|27574109|pdb|1N6E|I
Chain I, Tricorn Protease In Complex With A Tridecapeptide Chloromethyl Ketone Derivative gi|27574111|pdb|1N6E|K
Chain K, Tricorn Protease In Complex With A Tridecapeptide Chloromethyl Ketone Derivative gi|27574113|pdb|1N6F|A
Chain A, Tricorn Protease In Complex With Z-Phe-Diketo-Arg-Glu-Phe gi|27574114|pdb|1N6F|B
Chain B, Tricorn Protease In Complex With Z-Phe-Diketo-Arg-Glu-Phe gi|27574115|pdb|1N6F|C
Chain C, Tricorn Protease In Complex With Z-Phe-Diketo-Arg-Glu-Phe gi|27574116|pdb|1N6F|D
Chain D, Tricorn Protease In Complex With Z-Phe-Diketo-Arg-Glu-Phe gi|27574117|pdb|1N6F|E
Chain E, Tricorn Protease In Complex With Z-Phe-Diketo-Arg-Glu-Phe gi|27574118|pdb|1N6F|F
Chain F, Tricorn Protease In Complex With Z-Phe-Diketo-Arg-Glu-Phe Length = 1071 Score = 25.2 bits (52), Expect = 71 Identities = 6/7 (85%), Positives = 7/7 (100%) Query: 221 LQMYEEA 227 LQMY+EA Sbjct: 687 LQMYDEA 693
Score = 18.0 bits (35), Expect = 10556
Identities = 4/5 (80%), Positives = 5/5 (100%)
Query: 282 CEFKL 286
C+FKL
Sbjct: 767 CDFKL 771
>gi|28948924|pdb|1NKW|EChain E, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 212 Score = 24.8 bits (51), Expect = 96 Identities = 8/11 (72%), Positives = 8/11 (72%), Gaps = 3/11 (27%) Query: 150 EDYQINMSRIG 160 ED NMSRIG Sbjct: 25 ED---NMSRIG 32
>gi|4557950|pdb|1KAS|Beta-Ketoacyl-Acp Synthase Ii From Escherichia Coli gi|4929869|pdb|1B3N|A
Chain A, Beta-Ketoacyl Carrier Protein Synthase As A Drug Target, Implications From The Crystal Structure Of A Complex With The Inhibitor Cerulenin. Length = 412 Score = 24.8 bits (51), Expect = 96 Identities = 10/15 (66%), Positives = 12/15 (80%), Gaps = 2/15 (13%) Query: 166 AGAMLALASALWLRD 180 AGA LA+A+A LRD Sbjct: 277 AGAALAMANA--LRD 289
>gi|23200293|pdb|1KYW|AChain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde gi|23200294|pdb|1KYW|C
Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde gi|23200295|pdb|1KYW|F
Chain F, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde gi|23200296|pdb|1KYZ|A
Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase Ferulic Acid Complex gi|23200297|pdb|1KYZ|C
Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase Ferulic Acid Complex gi|23200298|pdb|1KYZ|E
Chain E, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase Ferulic Acid Complex Length = 365 Score = 24.8 bits (51), Expect = 96 Identities = 7/10 (70%), Positives = 9/10 (90%) Query: 104 DRIMRLLASY 113 DR++RLLA Y Sbjct: 78 DRMLRLLACY 87
>gi|15988460|pdb|1G2D|CChain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) gi|15988461|pdb|1G2D|F
Chain F, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Score = 24.4 bits (50), Expect = 128 Identities = 11/29 (37%), Positives = 13/29 (44%), Gaps = 15/29 (51%) Query: 99 NLDTHDRI------------MRLLASYSQ 115 NLDTH RI MR ++SQ Sbjct: 21 NLDTHIRIHTGQKPFQCRICMR---NFSQ 46
>gi|15988466|pdb|1G2F|CChain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) gi|15988467|pdb|1G2F|F
Chain F, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Score = 24.4 bits (50), Expect = 128 Identities = 11/29 (37%), Positives = 13/29 (44%), Gaps = 15/29 (51%) Query: 99 NLDTHDRI------------MRLLASYSQ 115 NLDTH RI MR ++SQ Sbjct: 21 NLDTHIRIHTGQKPFQCRICMR---NFSQ 46
>gi|15825778|pdb|1I7Z|AChain A, Antibody Gnc92h2 Bound To Ligand gi|15825780|pdb|1I7Z|C
Chain C, Antibody Gnc92h2 Bound To Ligand Length = 219 Score = 24.4 bits (50), Expect = 128 Identities = 8/15 (53%), Positives = 10/15 (66%), Gaps = 4/15 (26%) Query: 239 YYCLFNNDLTREVPP 253 YYCL+ +RE PP Sbjct: 90 YYCLY----SREFPP 100
>gi|33358149|pdb|1PSW|AChain A, Structure Of E. Coli Adp-Heptose Lps Heptosyltransferase Ii Length = 348 Score = 24.4 bits (50), Expect = 128 Identities = 8/12 (66%), Positives = 10/12 (83%), Gaps = 2/12 (16%) Query: 124 TLSPEARFPQAI 135 TL +AR+PQAI Sbjct: 23 TL--QARYPQAI 32
Score = 18.0 bits (35), Expect = 10556
Identities = 6/9 (66%), Positives = 6/9 (66%)
Query: 255 FIAGAEFDP 263
F GAEF P
Sbjct: 185 FCPGAEFGP 193
>gi|230255|pdb|1PP2|RChain R, Calcium-Free Phospholipase A2 (E.C.3.1.1.4) gi|230256|pdb|1PP2|L
Chain L, Calcium-Free Phospholipase A2 (E.C.3.1.1.4) Length = 122 Score = 24.4 bits (50), Expect = 128 Identities = 9/15 (60%), Positives = 10/15 (66%), Gaps = 2/15 (13%) Query: 187 KVAG--VLLWYGLYG 199 K+AG LLWY YG Sbjct: 11 KIAGRSGLLWYSAYG 25
>gi|24158677|pdb|1IRE|BChain B, Crystal Structure Of Co-Type Nitrile Hydratase From Pseudonocardia Thermophila Length = 228 Score = 24.4 bits (50), Expect = 128 Identities = 9/19 (47%), Positives = 9/19 (47%), Gaps = 6/19 (31%) Query: 222 QMYEEAYLSNDADRESPYY 240 QM YL ESPYY Sbjct: 57 QMNPAEYL------ESPYY 69
>gi|24987474|pdb|1KK7|AChain A, Scallop Myosin In The Near Rigor Conformation gi|24987477|pdb|1KK8|A
Chain A, Scallop Myosin (S1-Adp-Befx) In The Actin-Detached Conformation Length = 837 Score = 24.0 bits (49), Expect = 172 Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Query: 256 IAGAEFDP-LLDDSRLLYQ 273 IAGA+ + LL+ SR+ YQ Sbjct: 257 IAGADIETYLLEKSRVTYQ 275
Score = 17.6 bits (34), Expect = 14164
Identities = 4/4 (100%), Positives = 4/4 (100%)
Query: 220 DLQM 223
DLQM
Sbjct: 515 DLQM 518
>gi|7767090|pdb|1D6S|AChain A, Crystal Structure Of The K41a Mutant Of O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With Methionine gi|7767091|pdb|1D6S|B
Chain B, Crystal Structure Of The K41a Mutant Of O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With Methionine Length = 322 Score = 24.0 bits (49), Expect = 172 Identities = 8/10 (80%), Positives = 8/10 (80%) Query: 92 GGGFILGNLD 101 G GFI GNLD Sbjct: 230 GAGFIPGNLD 239
Score = 19.7 bits (39), Expect = 3257
Identities = 7/10 (70%), Positives = 7/10 (70%), Gaps = 3/10 (30%)
Query: 134 AI---EEIVA 140
AI EEIVA
Sbjct: 122 AIQKAEEIVA 131
>gi|5107466|pdb|1B7T|AChain A, Myosin Digested By Papain gi|24987497|pdb|1L2O|A
Chain A, Scallop Myosin S1-Adp-P-Pdm In The Actin-Detached Conformation gi|27065236|pdb|1KQM|A
Chain A, Scallop Myosin S1-Amppnp In The Actin-Detached Conformation gi|27065250|pdb|1KWO|A
Chain A, Scallop Myosin S1-Atpgammas-P-Pdm In The Actin-Detached Conformation Length = 835 Score = 24.0 bits (49), Expect = 172 Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Query: 256 IAGAEFDP-LLDDSRLLYQ 273 IAGA+ + LL+ SR+ YQ Sbjct: 257 IAGADIETYLLEKSRVTYQ 275
Score = 17.6 bits (34), Expect = 14164
Identities = 4/4 (100%), Positives = 4/4 (100%)
Query: 220 DLQM 223
DLQM
Sbjct: 515 DLQM 518
>gi|3114506|pdb|1PS1|AChain A, Pentalenene Synthase gi|3114507|pdb|1PS1|B
Chain B, Pentalenene Synthase Length = 337 Score = 24.0 bits (49), Expect = 172 Identities = 6/7 (85%), Positives = 6/7 (85%) Query: 47 ERRFWNA 53 E RFWNA Sbjct: 155 ESRFWNA 161
>gi|11514304|pdb|1DFL|AChain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State gi|11514307|pdb|1DFL|B
Chain B, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Score = 24.0 bits (49), Expect = 172 Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Query: 256 IAGAEFDP-LLDDSRLLYQ 273 IAGA+ + LL+ SR+ YQ Sbjct: 253 IAGADIETYLLEKSRVTYQ 271
Score = 17.6 bits (34), Expect = 14164
Identities = 4/4 (100%), Positives = 4/4 (100%)
Query: 220 DLQM 223
DLQM
Sbjct: 511 DLQM 514
Database: PDB protein database
Posted date: Sep 27, 2003 8:18 PM
Number of letters in database: 10,828,398
Number of sequences in database: 45,671
Lambda K H
0.338 0.284 1.80
Gapped
Lambda K H
0.294 0.110 0.610
Matrix: PAM30
Gap Penalties: Existence: 9, Extension: 1
Number of Hits to DB: 808,082
Number of Sequences: 45671
Number of extensions: 82283
Number of successful extensions: 731
Number of sequences better than 20000.0: 605
Number of HSP's better than 20000.0 without gapping: 605
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 728
length of query: 319
length of database: 10,828,398
effective HSP length: 26
effective length of query: 293
effective length of database: 9,640,952
effective search space: 2824798936
effective search space used: 2824798936
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 35 (14.8 bits)
X3: 58 (24.6 bits)
S1: 33 (17.9 bits)
S2: 33 (17.2 bits)