>gi|27574132|pdb|1N8I|AChain A, Biochemical And Structural Studies Of Malate Synthase From Mycobacterium Tuberculosis gi|27574139|pdb|1N8W|A
Chain A, Biochemical And Structural Studies Of Malate Synthase From Mycobacterium Tuberculosis gi|27574140|pdb|1N8W|B
Chain B, Biochemical And Structural Studies Of Malate Synthase From Mycobacterium Tuberculosis Length = 741 Score = 28.2 bits (59), Expect = 3.6 Identities = 11/20 (55%), Positives = 12/20 (60%), Gaps = 7/20 (35%) Query: 45 IERLL-----KE--WQPDEI 57 IE+LL KE W PDEI Sbjct: 575 IEQLLTIPLAKELAWAPDEI 594
Score = 16.3 bits (31), Expect = 13439
Identities = 4/5 (80%), Positives = 5/5 (100%)
Query: 128 IILES 132
+ILES
Sbjct: 260 VILES 264
Score = 15.9 bits (30), Expect = 18032
Identities = 4/4 (100%), Positives = 4/4 (100%)
Query: 76 ARKF 79
ARKF
Sbjct: 172 ARKF 175
>gi|33357505|pdb|1NVM|AChain A, Crystal Structure Of A Bifunctional Aldolase-Dehydrogenase : Sequestering A Reactive And Volatile Intermediate gi|33357507|pdb|1NVM|C
Chain C, Crystal Structure Of A Bifunctional Aldolase-Dehydrogenase : Sequestering A Reactive And Volatile Intermediate gi|33357509|pdb|1NVM|E
Chain E, Crystal Structure Of A Bifunctional Aldolase-Dehydrogenase : Sequestering A Reactive And Volatile Intermediate gi|33357511|pdb|1NVM|G
Chain G, Crystal Structure Of A Bifunctional Aldolase-Dehydrogenase : Sequestering A Reactive And Volatile Intermediate Length = 345 Score = 26.9 bits (56), Expect = 8.6 Identities = 8/10 (80%), Positives = 9/10 (90%) Query: 114 RALNKGKVDS 123 RAL+K KVDS Sbjct: 37 RALDKAKVDS 46
>gi|2098406|pdb|2MBR|Murb Wild Type, Complex With Enolpyruvyl-Udp-N-Acetylglucosamine Length = 340 Score = 25.2 bits (52), Expect = 28 Identities = 7/8 (87%), Positives = 7/8 (87%) Query: 47 RLLKEWQP 54 RL KEWQP Sbjct: 177 RLPKEWQP 184
Score = 16.8 bits (32), Expect = 10015
Identities = 4/6 (66%), Positives = 4/6 (66%)
Query: 48 LLKEWQ 53
LL WQ
Sbjct: 27 LLNAWQ 32
>gi|14278353|pdb|1IE7|CChain C, Phosphate Inhibited Bacillus Pasteurii Urease Crystal Structure Length = 570 Score = 25.2 bits (52), Expect = 28 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 12/29 (41%) Query: 39 TPD-WNIIERLLK--EWQPDEIIVGLPLN 64 TP WN IE++LK E GLP+N Sbjct: 174 TPGPWN-IEKMLKSTE--------GLPIN 193
>gi|14278394|pdb|1FN7|AChain A, Coupling Of Damage Recognition And Catalysis By A Human Base-Excision Dna Repair Protein Length = 317 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 184 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 212
>gi|4557957|pdb|1UBP|CChain C, Crystal Structure Of Urease From Bacillus Pasteurii Inhibited With Beta-Mercaptoethanol At 1.65 Angstroms Resolution gi|6573659|pdb|2UBP|C
Chain C, Structure Of Native Urease From Bacillus Pasteurii gi|6730599|pdb|3UBP|C
Chain C, Diamidophosphate Inhibited Bacillus Pasteurii Urease gi|7245484|pdb|4UBP|C
Chain C, Structure Of Bacillus Pasteurii Urease Inhibited With Acetohydroxamic Acid At 1.55 A Resolution Length = 570 Score = 25.2 bits (52), Expect = 28 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 12/29 (41%) Query: 39 TPD-WNIIERLLK--EWQPDEIIVGLPLN 64 TP WN IE++LK E GLP+N Sbjct: 174 TPGPWN-IEKMLKSTE--------GLPIN 193
>gi|28948715|pdb|1N39|AChain A, Structural And Biochemical Exploration Of A Critical Amino Acid In Human 8-Oxoguanine Glycosylase Length = 317 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 184 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 212
>gi|7546476|pdb|1EBM|AChain A, Crystal Structure Of The Human 8-Oxoguanine Glycosylase (Hogg1) Bound To A Substrate Oligonucleotide Length = 317 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 184 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 212
>gi|28948721|pdb|1N3C|AChain A, Structural And Biochemical Exploration Of A Critical Amino Acid In Human 8-Oxoguanine Glycosylase Length = 317 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 184 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 212
>gi|28948718|pdb|1N3A|AChain A, Structural And Biochemical Exploration Of A Critical Amino Acid In Human 8-Oxoguanine Glycosylase Length = 317 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 184 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 212
>gi|16975399|pdb|1F89|AChain A, Crystal Structure Of Yeast Hypothetical Protein, Yl85 gi|16975400|pdb|1F89|B
Chain B, Crystal Structure Of Yeast Hypothetical Protein, Yl85 Length = 291 Score = 25.2 bits (52), Expect = 28 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER +KE QPD +V LP Sbjct: 36 IERAMKE-QPDTKLVVLP 52
>gi|28948369|pdb|1HU0|AChain A, Crystal Structure Of An Hogg1-Dna Borohydride Trapped Intermediate Complex gi|28948498|pdb|1LWV|A
Chain A, Borohydride-Trapped Hogg1 Intermediate Structure Co- Crystallized With 8-Aminoguanine gi|28948501|pdb|1LWW|A
Chain A, Borohydride-Trapped Hogg1 Intermediate Structure Co- Crystallized With 8-Bromoguanine gi|28948504|pdb|1LWY|A
Chain A, Hogg1 Borohydride-Trapped Intermediate Without 8-Oxoguanine Length = 324 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 189 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 217
>gi|6573531|pdb|1D6G|AChain A, Molecular Complex Of Cholecystokinin-8 And N-Terminus Of The Cholecystokinin A Receptor By Nmr Spectroscopy Length = 47 Score = 25.2 bits (52), Expect = 28 Identities = 6/9 (66%), Positives = 8/9 (88%) Query: 50 KEWQPDEII 58 KEWQP ++I Sbjct: 37 KEWQPAQVI 45
>gi|18158657|pdb|1KO9|AChain A, Native Structure Of The Human 8-Oxoguanine Dna Glycosylase Hogg1 Length = 345 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 192 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 220
>gi|1827629|pdb|1MBT|Oxidoreductase gi|1827631|pdb|1MBB|
Oxidoreductase Length = 342 Score = 25.2 bits (52), Expect = 28 Identities = 7/8 (87%), Positives = 7/8 (87%) Query: 47 RLLKEWQP 54 RL KEWQP Sbjct: 179 RLPKEWQP 186
Score = 16.8 bits (32), Expect = 10015
Identities = 4/6 (66%), Positives = 4/6 (66%)
Query: 48 LLKEWQ 53
LL WQ
Sbjct: 29 LLNAWQ 34
>gi|2098437|pdb|1UXY|Murb Mutant With Ser 229 Replaced By Ala, Complex With Enolpyruvyl-Udp-N-Acetylglucosamine Length = 340 Score = 25.2 bits (52), Expect = 28 Identities = 7/8 (87%), Positives = 7/8 (87%) Query: 47 RLLKEWQP 54 RL KEWQP Sbjct: 177 RLPKEWQP 184
Score = 16.8 bits (32), Expect = 10015
Identities = 4/6 (66%), Positives = 4/6 (66%)
Query: 48 LLKEWQ 53
LL WQ
Sbjct: 27 LLNAWQ 32
>gi|21465840|pdb|1KIC|AChain A, Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma Vivax: Asp10ala Mutant In Complex With Inosine gi|21465841|pdb|1KIC|B
Chain B, Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma Vivax: Asp10ala Mutant In Complex With Inosine gi|21465842|pdb|1KIE|A
Chain A, Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma Vivax: Asp10ala Mutant In Complex With 3- Deaza-Adenosine gi|21465843|pdb|1KIE|B
Chain B, Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma Vivax: Asp10ala Mutant In Complex With 3- Deaza-Adenosine Length = 339 Score = 24.8 bits (51), Expect = 38 Identities = 8/15 (53%), Positives = 10/15 (66%), Gaps = 3/15 (20%) Query: 30 LPAIKAQDGTPDWNI 44 LP+ DGT +WNI Sbjct: 188 LPST---DGTAEWNI 199
>gi|2624424|pdb|2LBD|Ligand-Binding Domain Of The Human Retinoic Acid Receptor Gamma Bound To All-Trans Retinoic Acid gi|4557975|pdb|3LBD|
Ligand-Binding Domain Of The Human Retinoic Acid Receptor Gamma Bound To 9-Cis Retinoic Acid gi|4557977|pdb|4LBD|
Ligand-Binding Domain Of The Human Retinoic Acid Receptor Gamma Bound To The Synthetic Agonist Bms961 Length = 267 Score = 24.8 bits (51), Expect = 38 Identities = 7/9 (77%), Positives = 7/9 (77%) Query: 61 LPLNMDGTE 69 LPL MD TE Sbjct: 163 LPLEMDDTE 171
>gi|10835870|pdb|1FCX|AChain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The Rargamma-Selective Retinoid Bms184394 gi|10835872|pdb|1FCZ|A
Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The Panagonist Retinoid Bms181156 gi|24158599|pdb|1FD0|A
Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The Rargamma-Selective Retinoid Sr11254 Length = 235 Score = 24.8 bits (51), Expect = 38 Identities = 7/9 (77%), Positives = 7/9 (77%) Query: 61 LPLNMDGTE 69 LPL MD TE Sbjct: 137 LPLEMDDTE 145
>gi|17943413|pdb|1HP0|AChain A, Crystal Structure Of An Inosine-Adenosine-Guanosine- Preferring Nucleoside Hydrolase From Trypanosoma Vivax In Complex With The Substrate Analogue 3-Deaza-Adenosine gi|17943414|pdb|1HP0|B
Chain B, Crystal Structure Of An Inosine-Adenosine-Guanosine- Preferring Nucleoside Hydrolase From Trypanosoma Vivax In Complex With The Substrate Analogue 3-Deaza-Adenosine gi|17943415|pdb|1HOZ|A
Chain A, Crystal Structure Of An Inosine-Adenosine-Guanosine- Preferring Nucleoside Hydrolase From Trypanosoma Vivax gi|17943416|pdb|1HOZ|B
Chain B, Crystal Structure Of An Inosine-Adenosine-Guanosine- Preferring Nucleoside Hydrolase From Trypanosoma Vivax Length = 339 Score = 24.8 bits (51), Expect = 38 Identities = 8/15 (53%), Positives = 10/15 (66%), Gaps = 3/15 (20%) Query: 30 LPAIKAQDGTPDWNI 44 LP+ DGT +WNI Sbjct: 188 LPST---DGTAEWNI 199
>gi|10835871|pdb|1FCY|AChain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The RarbetaGAMMA-Selective Retinoid Cd564 Length = 236 Score = 24.8 bits (51), Expect = 38 Identities = 7/9 (77%), Positives = 7/9 (77%) Query: 61 LPLNMDGTE 69 LPL MD TE Sbjct: 138 LPLEMDDTE 146
>gi|9257146|pdb|1EXA|AChain A, Enantiomer Discrimination Illustrated By Crystal Structures Of The Human Retinoic Acid Receptor Hrargamma Ligand Binding Domain: The Complex With The Active R-Enantiomer Bms270394. gi|9257147|pdb|1EXX|A
Chain A, Enantiomer Discrimination Illustrated By Crystal Structures Of The Human Retinoic Acid Receptor Hrargamma Ligand Binding Domain: The Complex With The Inactive S-Enantiomer Bms270395. Length = 246 Score = 24.8 bits (51), Expect = 38 Identities = 7/9 (77%), Positives = 7/9 (77%) Query: 61 LPLNMDGTE 69 LPL MD TE Sbjct: 142 LPLEMDDTE 150
>gi|20151088|pdb|1KVN|AChain A, Solution Structure Of Protein Srp19 Of The Arhaeoglobus Fulgidus Signal Recognition Particle, 10 Structures gi|20151089|pdb|1KVV|A
Chain A, Solution Structure Of Protein Srp19 Of The Archaeoglobus Fulgidus Signal Recognition Particle, Minimized Average Structure Length = 104 Score = 24.8 bits (51), Expect = 38 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 5/23 (21%) Query: 82 RIHGRFGV-EVKLHDERLSTVEA 103 RI RF V VKLH+ L VEA Sbjct: 22 RIPRRFAVPNVKLHE--L--VEA 40
>gi|30749814|pdb|1O0P|AChain A, Solution Structure Of The Third Rna Recognition Motif (Rrm) Of U2af65 In Complex With An N-Terminal Sf1 Peptide Length = 104 Score = 24.8 bits (51), Expect = 38 Identities = 9/14 (64%), Positives = 10/14 (71%), Gaps = 2/14 (14%) Query: 70 QPLTARARKFANRI 83 Q LT R KFANR+ Sbjct: 76 QGLTGR--KFANRV 87
>gi|6137337|pdb|1CLI|AChain A, X-Ray Crystal Structure Of Aminoimidazole Ribonucleotide Synthetase (Purm), From The E. Coli Purine Biosynthetic Pathway, At 2.5 A Resolution gi|6137338|pdb|1CLI|B
Chain B, X-Ray Crystal Structure Of Aminoimidazole Ribonucleotide Synthetase (Purm), From The E. Coli Purine Biosynthetic Pathway, At 2.5 A Resolution gi|6137339|pdb|1CLI|C
Chain C, X-Ray Crystal Structure Of Aminoimidazole Ribonucleotide Synthetase (Purm), From The E. Coli Purine Biosynthetic Pathway, At 2.5 A Resolution gi|6137340|pdb|1CLI|D
Chain D, X-Ray Crystal Structure Of Aminoimidazole Ribonucleotide Synthetase (Purm), From The E. Coli Purine Biosynthetic Pathway, At 2.5 A Resolution Length = 345 Score = 24.4 bits (50), Expect = 50 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 2/12 (16%) Query: 119 GK--VDSASAVI 128 GK VD+ASAVI Sbjct: 112 GKLDVDTASAVI 123
>gi|3891692|pdb|1BKH|CChain C, Muconate Lactonizing Enzyme From Pseudomonas Putida Length = 359 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 3 IERI------DAIIVDLP 14
>gi|3891691|pdb|1BKH|BChain B, Muconate Lactonizing Enzyme From Pseudomonas Putida Length = 361 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 3 IERI------DAIIVDLP 14
>gi|6730023|pdb|2MUC|AChain A, Muconate Cycloisomerase Variant F329i gi|6730024|pdb|2MUC|B
Chain B, Muconate Cycloisomerase Variant F329i Length = 373 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 6 IERI------DAIIVDLP 17
>gi|1942990|pdb|1OCC|EChain E, Structure Of Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State gi|1943003|pdb|1OCC|R
Chain R, Structure Of Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State gi|4389083|pdb|2OCC|E
Chain E, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State gi|4389096|pdb|2OCC|R
Chain R, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State gi|5822142|pdb|1OCO|E
Chain E, Bovine Heart Cytochrome C Oxidase In Carbon Monoxide-Bound State gi|5822155|pdb|1OCO|R
Chain R, Bovine Heart Cytochrome C Oxidase In Carbon Monoxide-Bound State gi|5822168|pdb|1OCR|E
Chain E, Bovine Heart Cytochrome C Oxidase In The Fully Reduced State gi|5822181|pdb|1OCR|R
Chain R, Bovine Heart Cytochrome C Oxidase In The Fully Reduced State gi|5822194|pdb|1OCZ|E
Chain E, Bovine Heart Cytochrome C Oxidase In Azide-Bound State gi|5822207|pdb|1OCZ|R
Chain R, Bovine Heart Cytochrome C Oxidase In Azide-Bound State Length = 109 Score = 24.0 bits (49), Expect = 68 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 7/21 (33%) Query: 114 RA---LNKGKVDSASAVIILE 131 RA LN D ASAV ILE Sbjct: 53 RACRRLN----DFASAVRILE 69
>gi|1633161|pdb|1MUC|AChain A, Structure Of Muconate Lactonizing Enzyme At 1.85 Angstroms Resolution gi|1633162|pdb|1MUC|B
Chain B, Structure Of Muconate Lactonizing Enzyme At 1.85 Angstroms Resolution Length = 373 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 6 IERI------DAIIVDLP 17
>gi|3891690|pdb|1BKH|AChain A, Muconate Lactonizing Enzyme From Pseudomonas Putida Length = 358 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 3 IERI------DAIIVDLP 14
>gi|13399452|pdb|1F9C|AChain A, Crystal Structure Of Mle D178n Variant gi|13399453|pdb|1F9C|B
Chain B, Crystal Structure Of Mle D178n Variant Length = 372 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 5 IERI------DAIIVDLP 16
>gi|6730035|pdb|3MUC|AChain A, Muconate Cycloisomerase Variant I54v gi|6730036|pdb|3MUC|B
Chain B, Muconate Cycloisomerase Variant I54v Length = 369 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 3 IERI------DAIIVDLP 14
>gi|13399484|pdb|1G91|AChain A, Solution Structure Of Myeloid Progenitor Inhibitory Factor- 1 (Mpif-1) Length = 77 Score = 23.5 bits (48), Expect = 91 Identities = 6/6 (100%), Positives = 6/6 (100%) Query: 130 LESYFE 135 LESYFE Sbjct: 25 LESYFE 30
>gi|28948572|pdb|1M3W|AChain A, Crystal Structure Of A Molecular Maquette Scaffold gi|28948573|pdb|1M3W|B
Chain B, Crystal Structure Of A Molecular Maquette Scaffold gi|28948574|pdb|1M3W|C
Chain C, Crystal Structure Of A Molecular Maquette Scaffold gi|28948575|pdb|1M3W|D
Chain D, Crystal Structure Of A Molecular Maquette Scaffold Length = 32 Score = 23.5 bits (48), Expect = 91 Identities = 6/7 (85%), Positives = 7/7 (100%) Query: 92 KLHDERL 98 KLH+ERL Sbjct: 22 KLHEERL 28
Score = 17.6 bits (34), Expect = 5563
Identities = 6/10 (60%), Positives = 8/10 (80%), Gaps = 1/10 (10%)
Query: 88 GVEV-KLHDE 96
G E+ KLH+E
Sbjct: 3 GGEIWKLHEE 12
>gi|21465645|pdb|1IRU|DChain D, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution gi|21465659|pdb|1IRU|R
Chain R, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 248 Score = 23.5 bits (48), Expect = 91 Identities = 10/18 (55%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 88 GVE----VKLHDERLSTV 101 GVE KL DER TV Sbjct: 44 GVEKKSVAKLQDER--TV 59
>gi|494456|pdb|1POW|AChain A, Pyruvate Oxidase (E.C.1.2.3.3) (Wild Type) gi|494457|pdb|1POW|B
Chain B, Pyruvate Oxidase (E.C.1.2.3.3) (Wild Type) Length = 585 Score = 23.5 bits (48), Expect = 91 Identities = 11/17 (64%), Positives = 11/17 (64%), Gaps = 4/17 (23%) Query: 18 AVGQRITGTARPLPAIK 34 AV ITG RPLPA K Sbjct: 534 AV---ITG-DRPLPAEK 546
>gi|494458|pdb|1POX|AChain A, Pyruvate Oxidase (E.C.1.2.3.3) Mutant With Pro 178 Replaced By Ser, Ser 188 Replaced By Asn, And Ala 458 Replaced By Val (P178s,S188n,A458v) gi|494459|pdb|1POX|B
Chain B, Pyruvate Oxidase (E.C.1.2.3.3) Mutant With Pro 178 Replaced By Ser, Ser 188 Replaced By Asn, And Ala 458 Replaced By Val (P178s,S188n,A458v) Length = 585 Score = 23.5 bits (48), Expect = 91 Identities = 11/17 (64%), Positives = 11/17 (64%), Gaps = 4/17 (23%) Query: 18 AVGQRITGTARPLPAIK 34 AV ITG RPLPA K Sbjct: 534 AV---ITG-DRPLPAEK 546
>gi|28373303|pdb|1GZ6|AChain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 gi|28373304|pdb|1GZ6|B
Chain B, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 gi|28373305|pdb|1GZ6|C
Chain C, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 gi|28373306|pdb|1GZ6|D
Chain D, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 Length = 319 Score = 23.5 bits (48), Expect = 91 Identities = 5/7 (71%), Positives = 7/7 (100%) Query: 41 DWNIIER 47 DW+II+R Sbjct: 115 DWDIIQR 121
Score = 15.9 bits (30), Expect = 18032
Identities = 4/4 (100%), Positives = 4/4 (100%)
Query: 106 GLFE 109
GLFE
Sbjct: 235 GLFE 238
>gi|10835469|pdb|1FSK|BChain B, Complex Formation Between A Fab Fragment Of A Monoclonal Igg Antibody And The Major Allergen From Birch Pollen Bet V 1 gi|10835472|pdb|1FSK|E
Chain E, Complex Formation Between A Fab Fragment Of A Monoclonal Igg Antibody And The Major Allergen From Birch Pollen Bet V 1 gi|10835475|pdb|1FSK|H
Chain H, Complex Formation Between A Fab Fragment Of A Monoclonal Igg Antibody And The Major Allergen From Birch Pollen Bet V 1 gi|10835478|pdb|1FSK|K
Chain K, Complex Formation Between A Fab Fragment Of A Monoclonal Igg Antibody And The Major Allergen From Birch Pollen Bet V 1 Length = 214 Score = 23.5 bits (48), Expect = 91 Identities = 7/12 (58%), Positives = 11/12 (91%) Query: 13 KSIGVAVGQRIT 24 KS+ V+VG+R+T Sbjct: 9 KSMSVSVGERVT 20
>gi|4699811|pdb|1CEQ|AChain A, Chloroquine Binds In The Cofactor Binding Site Of Plasmodium Falciparum Lactate Dehydrogenase. Length = 316 Score = 23.5 bits (48), Expect = 91 Identities = 8/15 (53%), Positives = 10/15 (66%), Gaps = 3/15 (20%) Query: 50 KEWQPDEIIVGLPLN 64 KEW D++ LPLN Sbjct: 91 KEWNRDDL---LPLN 102
>gi|3891377|pdb|1LTM|Accelerated X-Ray Structure Elucidation Of A 36 Kda MuramidaseTRANSGLYCOSYLASE USING WARP Length = 320 Score = 23.1 bits (47), Expect = 122 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 19/38 (50%) Query: 39 TPD--------WNIIE----RLLKEWQ----PDEIIVG 60 TPD WN E R WQ P EIIVG Sbjct: 82 TPDNVQNGVVFWNQYEDALNR---AWQVYGVPPEIIVG 116
>gi|3114282|pdb|1RYP|NChain N, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution gi|3114296|pdb|1RYP|2
Chain 2, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution gi|11513425|pdb|1G65|M
Chain M, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A Molecular Basis For Selectivity Of Alpha,Beta-Epoxyketone Proteasome Inhibitors gi|11513439|pdb|1G65|1
Chain 1, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A Molecular Basis For Selectivity Of Alpha,Beta-Epoxyketone Proteasome Inhibitors gi|14488818|pdb|1FNT|N
Chain N, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution gi|14488832|pdb|1FNT|BB
Chain b, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution gi|20150389|pdb|1JD2|M
Chain M, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a Complex: A Non-Covalent Proteasome Inhibitor gi|20150396|pdb|1JD2|T
Chain T, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a Complex: A Non-Covalent Proteasome Inhibitor Length = 233 Score = 23.1 bits (47), Expect = 122 Identities = 6/7 (85%), Positives = 7/7 (100%) Query: 45 IERLLKE 51 IERLLK+ Sbjct: 63 IERLLKD 69
>gi|1065365|pdb|1AMY|Alpha-1,4 Glycan-4-Glucanohydrolase (Alpha-Amylase, High Pi Isozyme (Amy2)) (E.C.3.2.1.1) gi|4699831|pdb|1AVA|A
Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed gi|4699832|pdb|1AVA|B
Chain B, Amy2BASI PROTEIN-Protein Complex From Barley Seed gi|5542105|pdb|1BG9|
Barley Alpha-Amylase With Substrate Analogue Acarbose Length = 403 Score = 23.1 bits (47), Expect = 122 Identities = 9/13 (69%), Positives = 9/13 (69%), Gaps = 1/13 (7%) Query: 8 FDFGTKSI-GVAV 19 FDF TK I VAV Sbjct: 244 FDFTTKGILNVAV 256
Score = 17.2 bits (33), Expect = 7464
Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 8/28 (28%)
Query: 119 GKVDS-ASAVII---L----ESYFEQGY 138
GKVD A+A I L +S EQGY
Sbjct: 24 GKVDDIAAAGITHVWLPPASQSVAEQGY 51
>gi|22219179|pdb|1L1Y|AChain A, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219180|pdb|1L1Y|B
Chain B, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219181|pdb|1L1Y|C
Chain C, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219182|pdb|1L1Y|D
Chain D, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219183|pdb|1L1Y|E
Chain E, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219184|pdb|1L1Y|F
Chain F, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219185|pdb|1L2A|A
Chain A, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219186|pdb|1L2A|B
Chain B, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219187|pdb|1L2A|C
Chain C, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219188|pdb|1L2A|D
Chain D, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219189|pdb|1L2A|E
Chain E, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219190|pdb|1L2A|F
Chain F, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome Length = 678 Score = 23.1 bits (47), Expect = 122 Identities = 11/30 (36%), Positives = 14/30 (46%), Gaps = 14/30 (46%) Query: 42 WNIIERLLKEWQPDEIIVGLPLNMDGTEQP 71 W ++E +W II P D TEQP Sbjct: 113 WKVME----DW----II---P---DSTEQP 128
Score = 16.3 bits (31), Expect = 13439
Identities = 6/8 (75%), Positives = 6/8 (75%)
Query: 33 IKAQDGTP 40
I AQD TP
Sbjct: 306 IGAQDKTP 313
>gi|14278167|pdb|1G0S|AChain A, The Crystal Structure Of The E.Coli Adp-Ribose Pyrophosphatase gi|14278168|pdb|1G0S|B
Chain B, The Crystal Structure Of The E.Coli Adp-Ribose Pyrophosphatase gi|14278187|pdb|1G9Q|A
Chain A, Complex Structure Of The Adpr-Ase And Its Substrate Adp- Ribose gi|14278188|pdb|1G9Q|B
Chain B, Complex Structure Of The Adpr-Ase And Its Substrate Adp- Ribose gi|14278189|pdb|1GA7|A
Chain A, Crystal Structure Of The Adp-Ribose Pyrophosphatase In Complex With Gd+3 gi|14278190|pdb|1GA7|B
Chain B, Crystal Structure Of The Adp-Ribose Pyrophosphatase In Complex With Gd+3 gi|24987472|pdb|1KHZ|A
Chain A, Structure Of The Adpr-Ase In Complex With Ampcpr And Mg gi|24987473|pdb|1KHZ|B
Chain B, Structure Of The Adpr-Ase In Complex With Ampcpr And Mg Length = 209 Score = 23.1 bits (47), Expect = 122 Identities = 7/13 (53%), Positives = 12/13 (92%) Query: 119 GKVDSASAVIILE 131 GK+D+A++VI L+ Sbjct: 183 GKIDNAASVIALQ 195
>gi|3114421|pdb|1ZAK|AChain A, Adenylate Kinase From Maize In Complex With The Inhibitor P1,P5-Bis(Adenosine-5'-)pentaphosphate (Ap5a) gi|3114422|pdb|1ZAK|B
Chain B, Adenylate Kinase From Maize In Complex With The Inhibitor P1,P5-Bis(Adenosine-5'-)pentaphosphate (Ap5a) Length = 222 Score = 23.1 bits (47), Expect = 122 Identities = 7/12 (58%), Positives = 8/12 (66%), Gaps = 4/12 (33%) Query: 54 PDEIIVGLPLNM 65 PDEI+V NM Sbjct: 65 PDEIVV----NM 72
>gi|17943083|pdb|1JGV|HChain H, Structural Basis For Disfavored Elimination Reaction In Catalytic Antibody 1d4 Length = 218 Score = 23.1 bits (47), Expect = 122 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 7/18 (38%) Query: 90 EVKLHDERLSTVEARSGL 107 EVKL VE+R GL Sbjct: 1 EVKL-------VESRGGL 11
>gi|17943085|pdb|1JGU|HChain H, Structural Basis For Disfavored Elimination Reaction In Catalytic Antibody 1d4 Length = 217 Score = 23.1 bits (47), Expect = 122 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 7/18 (38%) Query: 90 EVKLHDERLSTVEARSGL 107 EVKL VE+R GL Sbjct: 1 EVKL-------VESRGGL 11
>gi|10120773|pdb|1DC4|AChain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes gi|10120774|pdb|1DC4|B
Chain B, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Score = 23.1 bits (47), Expect = 122 Identities = 8/11 (72%), Positives = 8/11 (72%), Gaps = 2/11 (18%) Query: 84 HGRFG--VEVK 92 HGRF VEVK Sbjct: 50 HGRFDGTVEVK 60
Database: PDB protein database
Posted date: Sep 27, 2003 8:18 PM
Number of letters in database: 10,828,398
Number of sequences in database: 45,671
Lambda K H
0.340 0.286 1.73
Gapped
Lambda K H
0.294 0.110 0.610
Matrix: PAM30
Gap Penalties: Existence: 9, Extension: 1
Number of Hits to DB: 467,475
Number of Sequences: 45671
Number of extensions: 44330
Number of successful extensions: 987
Number of sequences better than 20000.0: 784
Number of HSP's better than 20000.0 without gapping: 784
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 983
length of query: 138
length of database: 10,828,398
effective HSP length: 24
effective length of query: 114
effective length of database: 9,732,294
effective search space: 1109481516
effective search space used: 1109481516
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 35 (14.8 bits)
X3: 58 (24.6 bits)
S1: 30 (16.5 bits)
S2: 30 (15.9 bits)