BLASTP 2.2.6 [Apr-09-2003]
RID: 1064839109-25340-657165.BLASTQ3 Query= T0157 yqgF, E. coli (138 letters) Database: PDB protein database 45,671 sequences; 10,828,398 total letters Taxonomy reports
Query= T0157 yqgF, E. coli (138 letters)
Database: PDB protein database 45,671 sequences; 10,828,398 total letters Taxonomy reports
Related Structures Score E Sequences producing significant alignments: (bits) Value gi|27574132|pdb|1N8I|A Chain A, Biochemical And Structural ... 28 3.6 gi|33357505|pdb|1NVM|A Chain A, Crystal Structure Of A Bifu... 27 8.6 gi|2098406|pdb|2MBR| Murb Wild Type, Complex With Enolpyru... 25 28 gi|14278353|pdb|1IE7|C Chain C, Phosphate Inhibited Bacillu... 25 28 gi|14278394|pdb|1FN7|A Chain A, Coupling Of Damage Recognit... 25 28 gi|4557957|pdb|1UBP|C Chain C, Crystal Structure Of Urease ... 25 28 gi|28948715|pdb|1N39|A Chain A, Structural And Biochemical ... 25 28 gi|7546476|pdb|1EBM|A Chain A, Crystal Structure Of The Hum... 25 28 gi|28948721|pdb|1N3C|A Chain A, Structural And Biochemical ... 25 28 gi|28948718|pdb|1N3A|A Chain A, Structural And Biochemical ... 25 28 gi|16975399|pdb|1F89|A Chain A, Crystal Structure Of Yeast ... 25 28 gi|28948369|pdb|1HU0|A Chain A, Crystal Structure Of An Hog... 25 28 gi|6573531|pdb|1D6G|A Chain A, Molecular Complex Of Cholecy... 25 28 gi|18158657|pdb|1KO9|A Chain A, Native Structure Of The Hum... 25 28 gi|1827629|pdb|1MBT| Oxidoreductase >gi|1827631|pdb|1MBB| ... 25 28 gi|2098437|pdb|1UXY| Murb Mutant With Ser 229 Replaced By ... 25 28 gi|21465840|pdb|1KIC|A Chain A, Inosine-Adenosine-Guanosine... 25 38 gi|2624424|pdb|2LBD| Ligand-Binding Domain Of The Human Re... 25 38 gi|10835870|pdb|1FCX|A Chain A, Isotype Selectivity Of The ... 25 38 gi|17943413|pdb|1HP0|A Chain A, Crystal Structure Of An Ino... 25 38 gi|10835871|pdb|1FCY|A Chain A, Isotype Selectivity Of The ... 25 38 gi|9257146|pdb|1EXA|A Chain A, Enantiomer Discrimination Il... 25 38 gi|20151088|pdb|1KVN|A Chain A, Solution Structure Of Prote... 25 38 gi|30749814|pdb|1O0P|A Chain A, Solution Structure Of The T... 25 38 gi|6137337|pdb|1CLI|A Chain A, X-Ray Crystal Structure Of A... 24 50 gi|3891692|pdb|1BKH|C Chain C, Muconate Lactonizing Enzyme ... 24 68 gi|3891691|pdb|1BKH|B Chain B, Muconate Lactonizing Enzyme ... 24 68 gi|6730023|pdb|2MUC|A Chain A, Muconate Cycloisomerase Vari... 24 68 gi|1942990|pdb|1OCC|E Chain E, Structure Of Bovine Heart Cy... 24 68 gi|1633161|pdb|1MUC|A Chain A, Structure Of Muconate Lacton... 24 68 gi|3891690|pdb|1BKH|A Chain A, Muconate Lactonizing Enzyme ... 24 68 gi|13399452|pdb|1F9C|A Chain A, Crystal Structure Of Mle D1... 24 68 gi|6730035|pdb|3MUC|A Chain A, Muconate Cycloisomerase Vari... 24 68 gi|13399484|pdb|1G91|A Chain A, Solution Structure Of Myelo... 24 91 gi|28948572|pdb|1M3W|A Chain A, Crystal Structure Of A Mole... 24 91 gi|21465645|pdb|1IRU|D Chain D, Crystal Structure Of The Ma... 24 91 gi|494456|pdb|1POW|A Chain A, Pyruvate Oxidase (E.C.1.2.3.3... 24 91 gi|494458|pdb|1POX|A Chain A, Pyruvate Oxidase (E.C.1.2.3.3... 24 91 gi|28373303|pdb|1GZ6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydr... 24 91 gi|10835469|pdb|1FSK|B Chain B, Complex Formation Between A... 24 91 gi|4699811|pdb|1CEQ|A Chain A, Chloroquine Binds In The Cof... 24 91 gi|3891377|pdb|1LTM| Accelerated X-Ray Structure Elucidati... 23 122 gi|3114282|pdb|1RYP|N Chain N, Crystal Structure Of The 20s... 23 122 gi|1065365|pdb|1AMY| Alpha-1,4 Glycan-4-Glucanohydrolase (... 23 122 gi|22219179|pdb|1L1Y|A Chain A, The Crystal Structure And C... 23 122 gi|14278167|pdb|1G0S|A Chain A, The Crystal Structure Of Th... 23 122 gi|3114421|pdb|1ZAK|A Chain A, Adenylate Kinase From Maize ... 23 122 gi|17943083|pdb|1JGV|H Chain H, Structural Basis For Disfav... 23 122 gi|17943085|pdb|1JGU|H Chain H, Structural Basis For Disfav... 23 122 gi|10120773|pdb|1DC4|A Chain A, Structural Analysis Of Glyc... 23 122 gi|6137550|pdb|1QUS|A Chain A, 1.7 A Resolution Structure O... 23 122 gi|11514004|pdb|1G0U|M Chain M, A Gated Channel Into The Pr... 23 122 gi|1421424|pdb|1GAD|O Chain O, Mol_id: 1; Molecule: D-Glyce... 23 122 gi|1421428|pdb|1GAE|O Chain O, Mol_id: 1; Molecule: D-Glyce... 23 122 gi|15826757|pdb|1JK8|A Chain A, Crystal Structure Of A Huma... 23 163 gi|18655406|pdb|1FUE|A Chain A, Flavodoxin From Helicobacte... 23 163 gi|10835404|pdb|1EI5|A Chain A, Crystal Structure Of A D-Am... 23 163 gi|2981790|pdb|1KVT| Udp-Galactose 4-Epimerase Complexed W... 23 163 gi|2981789|pdb|1KVS| Udp-Galactose 4-Epimerase Complexed W... 23 163 gi|3318833|pdb|1KVQ| Udp-Galactose 4-Epimerase Complexed W... 23 163 gi|1942240|pdb|1XEL| Udp-Galactose 4-Epimerase From Escher... 23 163 gi|3891756|pdb|1A9Z| Udp-Galactose 4-Epimerase Mutant S124... 23 163 gi|2981788|pdb|1KVR| Udp-Galactose 4-Epimerase Complexed W... 23 163 gi|22219289|pdb|1LRK|A Chain A, Crystal Structure Of Escher... 23 163 gi|2914620|pdb|1UDC| Structure Of Udp-Galactose-4-Epimeras... 23 163 gi|18677786|pdb|1GPJ|A Chain A, Glutamyl-Trna Reductase Fro... 23 163 gi|3891755|pdb|1A9Y| Udp-Galactose 4-Epimerase Mutant S124... 23 163 gi|2981791|pdb|1KVU| Udp-Galactose 4-Epimerase Complexed W... 23 163 gi|20150886|pdb|1KKH|A Chain A, Crystal Structure Of The Me... 23 163 gi|15988223|pdb|1GDE|A Chain A, Crystal Structure Of Pyroco... 22 219 gi|17943123|pdb|1IK9|A Chain A, Crystal Structure Of A Xrcc... 22 219 gi|809393|pdb|1FCD|A Chain A, Flavocytochrome C Sulfide Deh... 22 219 gi|9955183|pdb|1F6A|B Chain B, Structure Of The Human Ige-F... 22 219 gi|1633543|pdb|1AER|A Chain A, Domain Iii Of Pseudomonas Ae... 22 219 gi|1127154|pdb|1DMA|A Chain A, Domain Iii Of Pseudomonas Ae... 22 219 gi|21465631|pdb|1IPK|A Chain A, Crystal Structures Of Recom... 22 219 gi|1633544|pdb|1AER|B Chain B, Domain Iii Of Pseudomonas Ae... 22 219 gi|18655633|pdb|1H88|C Chain C, Crystal Structure Of Ternar... 22 219 gi|10120642|pdb|1ES6|A Chain A, Crystal Structure Of The Ma... 22 219 gi|30749244|pdb|1H2C|A Chain A, Ebola Virus Matrix Protein ... 22 219 gi|12084772|pdb|1EDY|A Chain A, Crystal Structure Of Rat Al... 22 219 gi|2781160|pdb|1AK1| Ferrochelatase From Bacillus Subtilis... 22 219 gi|2914353|pdb|1MPG|A Chain A, 3-Methyladenine Dna Glycosyl... 22 219 gi|33356950|pdb|1GUU|A Chain A, Crystal Structure Of C-Myb R1 22 219 gi|6980657|pdb|1DOZ|A Chain A, Crystal Structure Of Ferroch... 22 219 gi|17943391|pdb|1IKQ|A Chain A, Pseudomonas Aeruginosa Exot... 22 219 gi|7546417|pdb|1C9E|A Chain A, Structure Of Ferrochelatase ... 22 219 gi|1127253|pdb|1MBF| Mouse C-Myb Dna-Binding Domain Repeat... 22 219 gi|14278621|pdb|1DJU|A Chain A, Crystal Structure Of Aromat... 22 219 gi|21465628|pdb|1IPJ|A Chain A, Crystal Structures Of Recom... 22 219 gi|17943392|pdb|1IKP|A Chain A, Pseudomonas Aeruginosa Exot... 22 219 gi|30749246|pdb|1H2D|A Chain A, Ebola Virus Matrix Protein ... 22 219 gi|24159133|pdb|1O0V|A Chain A, The Crystal Structure Of Ig... 22 219 gi|12084561|pdb|1FU1|A Chain A, Crystal Structure Of Human ... 22 219 gi|15826572|pdb|1JK9|B Chain B, Heterodimer Between H48f-Ys... 22 294 gi|20150134|pdb|1IB8|A Chain A, Solution Structure And Func... 22 294 gi|24987456|pdb|1K9X|A Chain A, Structure Of Pyrococcus Fur... 22 294 gi|15988217|pdb|1FX0|B Chain B, Crystal Structure Of The Ch... 22 294 gi|7546394|pdb|1D5A|A Chain A, Crystal Structure Of An Arch... 22 294 gi|8569297|pdb|1QHT|A Chain A, Dna Polymerase From Thermoco... 22 294 Alignments
Related Structures Score E Sequences producing significant alignments: (bits) Value gi|27574132|pdb|1N8I|A Chain A, Biochemical And Structural ... 28 3.6 gi|33357505|pdb|1NVM|A Chain A, Crystal Structure Of A Bifu... 27 8.6 gi|2098406|pdb|2MBR| Murb Wild Type, Complex With Enolpyru... 25 28 gi|14278353|pdb|1IE7|C Chain C, Phosphate Inhibited Bacillu... 25 28 gi|14278394|pdb|1FN7|A Chain A, Coupling Of Damage Recognit... 25 28 gi|4557957|pdb|1UBP|C Chain C, Crystal Structure Of Urease ... 25 28 gi|28948715|pdb|1N39|A Chain A, Structural And Biochemical ... 25 28 gi|7546476|pdb|1EBM|A Chain A, Crystal Structure Of The Hum... 25 28 gi|28948721|pdb|1N3C|A Chain A, Structural And Biochemical ... 25 28 gi|28948718|pdb|1N3A|A Chain A, Structural And Biochemical ... 25 28 gi|16975399|pdb|1F89|A Chain A, Crystal Structure Of Yeast ... 25 28 gi|28948369|pdb|1HU0|A Chain A, Crystal Structure Of An Hog... 25 28 gi|6573531|pdb|1D6G|A Chain A, Molecular Complex Of Cholecy... 25 28 gi|18158657|pdb|1KO9|A Chain A, Native Structure Of The Hum... 25 28 gi|1827629|pdb|1MBT| Oxidoreductase >gi|1827631|pdb|1MBB| ... 25 28 gi|2098437|pdb|1UXY| Murb Mutant With Ser 229 Replaced By ... 25 28 gi|21465840|pdb|1KIC|A Chain A, Inosine-Adenosine-Guanosine... 25 38 gi|2624424|pdb|2LBD| Ligand-Binding Domain Of The Human Re... 25 38 gi|10835870|pdb|1FCX|A Chain A, Isotype Selectivity Of The ... 25 38 gi|17943413|pdb|1HP0|A Chain A, Crystal Structure Of An Ino... 25 38 gi|10835871|pdb|1FCY|A Chain A, Isotype Selectivity Of The ... 25 38 gi|9257146|pdb|1EXA|A Chain A, Enantiomer Discrimination Il... 25 38 gi|20151088|pdb|1KVN|A Chain A, Solution Structure Of Prote... 25 38 gi|30749814|pdb|1O0P|A Chain A, Solution Structure Of The T... 25 38 gi|6137337|pdb|1CLI|A Chain A, X-Ray Crystal Structure Of A... 24 50 gi|3891692|pdb|1BKH|C Chain C, Muconate Lactonizing Enzyme ... 24 68 gi|3891691|pdb|1BKH|B Chain B, Muconate Lactonizing Enzyme ... 24 68 gi|6730023|pdb|2MUC|A Chain A, Muconate Cycloisomerase Vari... 24 68 gi|1942990|pdb|1OCC|E Chain E, Structure Of Bovine Heart Cy... 24 68 gi|1633161|pdb|1MUC|A Chain A, Structure Of Muconate Lacton... 24 68 gi|3891690|pdb|1BKH|A Chain A, Muconate Lactonizing Enzyme ... 24 68 gi|13399452|pdb|1F9C|A Chain A, Crystal Structure Of Mle D1... 24 68 gi|6730035|pdb|3MUC|A Chain A, Muconate Cycloisomerase Vari... 24 68 gi|13399484|pdb|1G91|A Chain A, Solution Structure Of Myelo... 24 91 gi|28948572|pdb|1M3W|A Chain A, Crystal Structure Of A Mole... 24 91 gi|21465645|pdb|1IRU|D Chain D, Crystal Structure Of The Ma... 24 91 gi|494456|pdb|1POW|A Chain A, Pyruvate Oxidase (E.C.1.2.3.3... 24 91 gi|494458|pdb|1POX|A Chain A, Pyruvate Oxidase (E.C.1.2.3.3... 24 91 gi|28373303|pdb|1GZ6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydr... 24 91 gi|10835469|pdb|1FSK|B Chain B, Complex Formation Between A... 24 91 gi|4699811|pdb|1CEQ|A Chain A, Chloroquine Binds In The Cof... 24 91 gi|3891377|pdb|1LTM| Accelerated X-Ray Structure Elucidati... 23 122 gi|3114282|pdb|1RYP|N Chain N, Crystal Structure Of The 20s... 23 122 gi|1065365|pdb|1AMY| Alpha-1,4 Glycan-4-Glucanohydrolase (... 23 122 gi|22219179|pdb|1L1Y|A Chain A, The Crystal Structure And C... 23 122 gi|14278167|pdb|1G0S|A Chain A, The Crystal Structure Of Th... 23 122 gi|3114421|pdb|1ZAK|A Chain A, Adenylate Kinase From Maize ... 23 122 gi|17943083|pdb|1JGV|H Chain H, Structural Basis For Disfav... 23 122 gi|17943085|pdb|1JGU|H Chain H, Structural Basis For Disfav... 23 122 gi|10120773|pdb|1DC4|A Chain A, Structural Analysis Of Glyc... 23 122 gi|6137550|pdb|1QUS|A Chain A, 1.7 A Resolution Structure O... 23 122 gi|11514004|pdb|1G0U|M Chain M, A Gated Channel Into The Pr... 23 122 gi|1421424|pdb|1GAD|O Chain O, Mol_id: 1; Molecule: D-Glyce... 23 122 gi|1421428|pdb|1GAE|O Chain O, Mol_id: 1; Molecule: D-Glyce... 23 122 gi|15826757|pdb|1JK8|A Chain A, Crystal Structure Of A Huma... 23 163 gi|18655406|pdb|1FUE|A Chain A, Flavodoxin From Helicobacte... 23 163 gi|10835404|pdb|1EI5|A Chain A, Crystal Structure Of A D-Am... 23 163 gi|2981790|pdb|1KVT| Udp-Galactose 4-Epimerase Complexed W... 23 163 gi|2981789|pdb|1KVS| Udp-Galactose 4-Epimerase Complexed W... 23 163 gi|3318833|pdb|1KVQ| Udp-Galactose 4-Epimerase Complexed W... 23 163 gi|1942240|pdb|1XEL| Udp-Galactose 4-Epimerase From Escher... 23 163 gi|3891756|pdb|1A9Z| Udp-Galactose 4-Epimerase Mutant S124... 23 163 gi|2981788|pdb|1KVR| Udp-Galactose 4-Epimerase Complexed W... 23 163 gi|22219289|pdb|1LRK|A Chain A, Crystal Structure Of Escher... 23 163 gi|2914620|pdb|1UDC| Structure Of Udp-Galactose-4-Epimeras... 23 163 gi|18677786|pdb|1GPJ|A Chain A, Glutamyl-Trna Reductase Fro... 23 163 gi|3891755|pdb|1A9Y| Udp-Galactose 4-Epimerase Mutant S124... 23 163 gi|2981791|pdb|1KVU| Udp-Galactose 4-Epimerase Complexed W... 23 163 gi|20150886|pdb|1KKH|A Chain A, Crystal Structure Of The Me... 23 163 gi|15988223|pdb|1GDE|A Chain A, Crystal Structure Of Pyroco... 22 219 gi|17943123|pdb|1IK9|A Chain A, Crystal Structure Of A Xrcc... 22 219 gi|809393|pdb|1FCD|A Chain A, Flavocytochrome C Sulfide Deh... 22 219 gi|9955183|pdb|1F6A|B Chain B, Structure Of The Human Ige-F... 22 219 gi|1633543|pdb|1AER|A Chain A, Domain Iii Of Pseudomonas Ae... 22 219 gi|1127154|pdb|1DMA|A Chain A, Domain Iii Of Pseudomonas Ae... 22 219 gi|21465631|pdb|1IPK|A Chain A, Crystal Structures Of Recom... 22 219 gi|1633544|pdb|1AER|B Chain B, Domain Iii Of Pseudomonas Ae... 22 219 gi|18655633|pdb|1H88|C Chain C, Crystal Structure Of Ternar... 22 219 gi|10120642|pdb|1ES6|A Chain A, Crystal Structure Of The Ma... 22 219 gi|30749244|pdb|1H2C|A Chain A, Ebola Virus Matrix Protein ... 22 219 gi|12084772|pdb|1EDY|A Chain A, Crystal Structure Of Rat Al... 22 219 gi|2781160|pdb|1AK1| Ferrochelatase From Bacillus Subtilis... 22 219 gi|2914353|pdb|1MPG|A Chain A, 3-Methyladenine Dna Glycosyl... 22 219 gi|33356950|pdb|1GUU|A Chain A, Crystal Structure Of C-Myb R1 22 219 gi|6980657|pdb|1DOZ|A Chain A, Crystal Structure Of Ferroch... 22 219 gi|17943391|pdb|1IKQ|A Chain A, Pseudomonas Aeruginosa Exot... 22 219 gi|7546417|pdb|1C9E|A Chain A, Structure Of Ferrochelatase ... 22 219 gi|1127253|pdb|1MBF| Mouse C-Myb Dna-Binding Domain Repeat... 22 219 gi|14278621|pdb|1DJU|A Chain A, Crystal Structure Of Aromat... 22 219 gi|21465628|pdb|1IPJ|A Chain A, Crystal Structures Of Recom... 22 219 gi|17943392|pdb|1IKP|A Chain A, Pseudomonas Aeruginosa Exot... 22 219 gi|30749246|pdb|1H2D|A Chain A, Ebola Virus Matrix Protein ... 22 219 gi|24159133|pdb|1O0V|A Chain A, The Crystal Structure Of Ig... 22 219 gi|12084561|pdb|1FU1|A Chain A, Crystal Structure Of Human ... 22 219 gi|15826572|pdb|1JK9|B Chain B, Heterodimer Between H48f-Ys... 22 294 gi|20150134|pdb|1IB8|A Chain A, Solution Structure And Func... 22 294 gi|24987456|pdb|1K9X|A Chain A, Structure Of Pyrococcus Fur... 22 294 gi|15988217|pdb|1FX0|B Chain B, Crystal Structure Of The Ch... 22 294 gi|7546394|pdb|1D5A|A Chain A, Crystal Structure Of An Arch... 22 294 gi|8569297|pdb|1QHT|A Chain A, Dna Polymerase From Thermoco... 22 294
>gi|27574132|pdb|1N8I|A Chain A, Biochemical And Structural Studies Of Malate Synthase From Mycobacterium Tuberculosis gi|27574139|pdb|1N8W|A Chain A, Biochemical And Structural Studies Of Malate Synthase From Mycobacterium Tuberculosis gi|27574140|pdb|1N8W|B Chain B, Biochemical And Structural Studies Of Malate Synthase From Mycobacterium Tuberculosis Length = 741 Score = 28.2 bits (59), Expect = 3.6 Identities = 11/20 (55%), Positives = 12/20 (60%), Gaps = 7/20 (35%) Query: 45 IERLL-----KE--WQPDEI 57 IE+LL KE W PDEI Sbjct: 575 IEQLLTIPLAKELAWAPDEI 594
Score = 16.3 bits (31), Expect = 13439 Identities = 4/5 (80%), Positives = 5/5 (100%) Query: 128 IILES 132 +ILES Sbjct: 260 VILES 264
Score = 15.9 bits (30), Expect = 18032 Identities = 4/4 (100%), Positives = 4/4 (100%) Query: 76 ARKF 79 ARKF Sbjct: 172 ARKF 175
>gi|33357505|pdb|1NVM|A Chain A, Crystal Structure Of A Bifunctional Aldolase-Dehydrogenase : Sequestering A Reactive And Volatile Intermediate gi|33357507|pdb|1NVM|C Chain C, Crystal Structure Of A Bifunctional Aldolase-Dehydrogenase : Sequestering A Reactive And Volatile Intermediate gi|33357509|pdb|1NVM|E Chain E, Crystal Structure Of A Bifunctional Aldolase-Dehydrogenase : Sequestering A Reactive And Volatile Intermediate gi|33357511|pdb|1NVM|G Chain G, Crystal Structure Of A Bifunctional Aldolase-Dehydrogenase : Sequestering A Reactive And Volatile Intermediate Length = 345 Score = 26.9 bits (56), Expect = 8.6 Identities = 8/10 (80%), Positives = 9/10 (90%) Query: 114 RALNKGKVDS 123 RAL+K KVDS Sbjct: 37 RALDKAKVDS 46
>gi|2098406|pdb|2MBR| Murb Wild Type, Complex With Enolpyruvyl-Udp-N-Acetylglucosamine Length = 340 Score = 25.2 bits (52), Expect = 28 Identities = 7/8 (87%), Positives = 7/8 (87%) Query: 47 RLLKEWQP 54 RL KEWQP Sbjct: 177 RLPKEWQP 184
Score = 16.8 bits (32), Expect = 10015 Identities = 4/6 (66%), Positives = 4/6 (66%) Query: 48 LLKEWQ 53 LL WQ Sbjct: 27 LLNAWQ 32
>gi|14278353|pdb|1IE7|C Chain C, Phosphate Inhibited Bacillus Pasteurii Urease Crystal Structure Length = 570 Score = 25.2 bits (52), Expect = 28 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 12/29 (41%) Query: 39 TPD-WNIIERLLK--EWQPDEIIVGLPLN 64 TP WN IE++LK E GLP+N Sbjct: 174 TPGPWN-IEKMLKSTE--------GLPIN 193
>gi|14278394|pdb|1FN7|A Chain A, Coupling Of Damage Recognition And Catalysis By A Human Base-Excision Dna Repair Protein Length = 317 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 184 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 212
>gi|4557957|pdb|1UBP|C Chain C, Crystal Structure Of Urease From Bacillus Pasteurii Inhibited With Beta-Mercaptoethanol At 1.65 Angstroms Resolution gi|6573659|pdb|2UBP|C Chain C, Structure Of Native Urease From Bacillus Pasteurii gi|6730599|pdb|3UBP|C Chain C, Diamidophosphate Inhibited Bacillus Pasteurii Urease gi|7245484|pdb|4UBP|C Chain C, Structure Of Bacillus Pasteurii Urease Inhibited With Acetohydroxamic Acid At 1.55 A Resolution Length = 570 Score = 25.2 bits (52), Expect = 28 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 12/29 (41%) Query: 39 TPD-WNIIERLLK--EWQPDEIIVGLPLN 64 TP WN IE++LK E GLP+N Sbjct: 174 TPGPWN-IEKMLKSTE--------GLPIN 193
>gi|28948715|pdb|1N39|A Chain A, Structural And Biochemical Exploration Of A Critical Amino Acid In Human 8-Oxoguanine Glycosylase Length = 317 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 184 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 212
>gi|7546476|pdb|1EBM|A Chain A, Crystal Structure Of The Human 8-Oxoguanine Glycosylase (Hogg1) Bound To A Substrate Oligonucleotide Length = 317 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 184 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 212
>gi|28948721|pdb|1N3C|A Chain A, Structural And Biochemical Exploration Of A Critical Amino Acid In Human 8-Oxoguanine Glycosylase Length = 317 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 184 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 212
>gi|28948718|pdb|1N3A|A Chain A, Structural And Biochemical Exploration Of A Critical Amino Acid In Human 8-Oxoguanine Glycosylase Length = 317 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 184 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 212
>gi|16975399|pdb|1F89|A Chain A, Crystal Structure Of Yeast Hypothetical Protein, Yl85 gi|16975400|pdb|1F89|B Chain B, Crystal Structure Of Yeast Hypothetical Protein, Yl85 Length = 291 Score = 25.2 bits (52), Expect = 28 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER +KE QPD +V LP Sbjct: 36 IERAMKE-QPDTKLVVLP 52
>gi|28948369|pdb|1HU0|A Chain A, Crystal Structure Of An Hogg1-Dna Borohydride Trapped Intermediate Complex gi|28948498|pdb|1LWV|A Chain A, Borohydride-Trapped Hogg1 Intermediate Structure Co- Crystallized With 8-Aminoguanine gi|28948501|pdb|1LWW|A Chain A, Borohydride-Trapped Hogg1 Intermediate Structure Co- Crystallized With 8-Bromoguanine gi|28948504|pdb|1LWY|A Chain A, Hogg1 Borohydride-Trapped Intermediate Without 8-Oxoguanine Length = 324 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 189 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 217
>gi|6573531|pdb|1D6G|A Chain A, Molecular Complex Of Cholecystokinin-8 And N-Terminus Of The Cholecystokinin A Receptor By Nmr Spectroscopy Length = 47 Score = 25.2 bits (52), Expect = 28 Identities = 6/9 (66%), Positives = 8/9 (88%) Query: 50 KEWQPDEII 58 KEWQP ++I Sbjct: 37 KEWQPAQVI 45
>gi|18158657|pdb|1KO9|A Chain A, Native Structure Of The Human 8-Oxoguanine Dna Glycosylase Hogg1 Length = 345 Score = 25.2 bits (52), Expect = 28 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 16/41 (39%) Query: 101 VEA--RS-GLFEQGGYRALNKGK-VDSASAVIILESYFEQG 137 VEA R GL GYRA + V SASA ILE EQG Sbjct: 192 VEAHLRKLGL----GYRA----RYV-SASARAILE---EQG 220
>gi|1827629|pdb|1MBT| Oxidoreductase gi|1827631|pdb|1MBB| Oxidoreductase Length = 342 Score = 25.2 bits (52), Expect = 28 Identities = 7/8 (87%), Positives = 7/8 (87%) Query: 47 RLLKEWQP 54 RL KEWQP Sbjct: 179 RLPKEWQP 186
Score = 16.8 bits (32), Expect = 10015 Identities = 4/6 (66%), Positives = 4/6 (66%) Query: 48 LLKEWQ 53 LL WQ Sbjct: 29 LLNAWQ 34
>gi|2098437|pdb|1UXY| Murb Mutant With Ser 229 Replaced By Ala, Complex With Enolpyruvyl-Udp-N-Acetylglucosamine Length = 340 Score = 25.2 bits (52), Expect = 28 Identities = 7/8 (87%), Positives = 7/8 (87%) Query: 47 RLLKEWQP 54 RL KEWQP Sbjct: 177 RLPKEWQP 184
>gi|21465840|pdb|1KIC|A Chain A, Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma Vivax: Asp10ala Mutant In Complex With Inosine gi|21465841|pdb|1KIC|B Chain B, Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma Vivax: Asp10ala Mutant In Complex With Inosine gi|21465842|pdb|1KIE|A Chain A, Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma Vivax: Asp10ala Mutant In Complex With 3- Deaza-Adenosine gi|21465843|pdb|1KIE|B Chain B, Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma Vivax: Asp10ala Mutant In Complex With 3- Deaza-Adenosine Length = 339 Score = 24.8 bits (51), Expect = 38 Identities = 8/15 (53%), Positives = 10/15 (66%), Gaps = 3/15 (20%) Query: 30 LPAIKAQDGTPDWNI 44 LP+ DGT +WNI Sbjct: 188 LPST---DGTAEWNI 199
>gi|2624424|pdb|2LBD| Ligand-Binding Domain Of The Human Retinoic Acid Receptor Gamma Bound To All-Trans Retinoic Acid gi|4557975|pdb|3LBD| Ligand-Binding Domain Of The Human Retinoic Acid Receptor Gamma Bound To 9-Cis Retinoic Acid gi|4557977|pdb|4LBD| Ligand-Binding Domain Of The Human Retinoic Acid Receptor Gamma Bound To The Synthetic Agonist Bms961 Length = 267 Score = 24.8 bits (51), Expect = 38 Identities = 7/9 (77%), Positives = 7/9 (77%) Query: 61 LPLNMDGTE 69 LPL MD TE Sbjct: 163 LPLEMDDTE 171
>gi|10835870|pdb|1FCX|A Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The Rargamma-Selective Retinoid Bms184394 gi|10835872|pdb|1FCZ|A Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The Panagonist Retinoid Bms181156 gi|24158599|pdb|1FD0|A Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The Rargamma-Selective Retinoid Sr11254 Length = 235 Score = 24.8 bits (51), Expect = 38 Identities = 7/9 (77%), Positives = 7/9 (77%) Query: 61 LPLNMDGTE 69 LPL MD TE Sbjct: 137 LPLEMDDTE 145
>gi|17943413|pdb|1HP0|A Chain A, Crystal Structure Of An Inosine-Adenosine-Guanosine- Preferring Nucleoside Hydrolase From Trypanosoma Vivax In Complex With The Substrate Analogue 3-Deaza-Adenosine gi|17943414|pdb|1HP0|B Chain B, Crystal Structure Of An Inosine-Adenosine-Guanosine- Preferring Nucleoside Hydrolase From Trypanosoma Vivax In Complex With The Substrate Analogue 3-Deaza-Adenosine gi|17943415|pdb|1HOZ|A Chain A, Crystal Structure Of An Inosine-Adenosine-Guanosine- Preferring Nucleoside Hydrolase From Trypanosoma Vivax gi|17943416|pdb|1HOZ|B Chain B, Crystal Structure Of An Inosine-Adenosine-Guanosine- Preferring Nucleoside Hydrolase From Trypanosoma Vivax Length = 339 Score = 24.8 bits (51), Expect = 38 Identities = 8/15 (53%), Positives = 10/15 (66%), Gaps = 3/15 (20%) Query: 30 LPAIKAQDGTPDWNI 44 LP+ DGT +WNI Sbjct: 188 LPST---DGTAEWNI 199
>gi|10835871|pdb|1FCY|A Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The RarbetaGAMMA-Selective Retinoid Cd564 Length = 236 Score = 24.8 bits (51), Expect = 38 Identities = 7/9 (77%), Positives = 7/9 (77%) Query: 61 LPLNMDGTE 69 LPL MD TE Sbjct: 138 LPLEMDDTE 146
>gi|9257146|pdb|1EXA|A Chain A, Enantiomer Discrimination Illustrated By Crystal Structures Of The Human Retinoic Acid Receptor Hrargamma Ligand Binding Domain: The Complex With The Active R-Enantiomer Bms270394. gi|9257147|pdb|1EXX|A Chain A, Enantiomer Discrimination Illustrated By Crystal Structures Of The Human Retinoic Acid Receptor Hrargamma Ligand Binding Domain: The Complex With The Inactive S-Enantiomer Bms270395. Length = 246 Score = 24.8 bits (51), Expect = 38 Identities = 7/9 (77%), Positives = 7/9 (77%) Query: 61 LPLNMDGTE 69 LPL MD TE Sbjct: 142 LPLEMDDTE 150
>gi|20151088|pdb|1KVN|A Chain A, Solution Structure Of Protein Srp19 Of The Arhaeoglobus Fulgidus Signal Recognition Particle, 10 Structures gi|20151089|pdb|1KVV|A Chain A, Solution Structure Of Protein Srp19 Of The Archaeoglobus Fulgidus Signal Recognition Particle, Minimized Average Structure Length = 104 Score = 24.8 bits (51), Expect = 38 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 5/23 (21%) Query: 82 RIHGRFGV-EVKLHDERLSTVEA 103 RI RF V VKLH+ L VEA Sbjct: 22 RIPRRFAVPNVKLHE--L--VEA 40
>gi|30749814|pdb|1O0P|A Chain A, Solution Structure Of The Third Rna Recognition Motif (Rrm) Of U2af65 In Complex With An N-Terminal Sf1 Peptide Length = 104 Score = 24.8 bits (51), Expect = 38 Identities = 9/14 (64%), Positives = 10/14 (71%), Gaps = 2/14 (14%) Query: 70 QPLTARARKFANRI 83 Q LT R KFANR+ Sbjct: 76 QGLTGR--KFANRV 87
>gi|6137337|pdb|1CLI|A Chain A, X-Ray Crystal Structure Of Aminoimidazole Ribonucleotide Synthetase (Purm), From The E. Coli Purine Biosynthetic Pathway, At 2.5 A Resolution gi|6137338|pdb|1CLI|B Chain B, X-Ray Crystal Structure Of Aminoimidazole Ribonucleotide Synthetase (Purm), From The E. Coli Purine Biosynthetic Pathway, At 2.5 A Resolution gi|6137339|pdb|1CLI|C Chain C, X-Ray Crystal Structure Of Aminoimidazole Ribonucleotide Synthetase (Purm), From The E. Coli Purine Biosynthetic Pathway, At 2.5 A Resolution gi|6137340|pdb|1CLI|D Chain D, X-Ray Crystal Structure Of Aminoimidazole Ribonucleotide Synthetase (Purm), From The E. Coli Purine Biosynthetic Pathway, At 2.5 A Resolution Length = 345 Score = 24.4 bits (50), Expect = 50 Identities = 9/12 (75%), Positives = 10/12 (83%), Gaps = 2/12 (16%) Query: 119 GK--VDSASAVI 128 GK VD+ASAVI Sbjct: 112 GKLDVDTASAVI 123
>gi|3891692|pdb|1BKH|C Chain C, Muconate Lactonizing Enzyme From Pseudomonas Putida Length = 359 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 3 IERI------DAIIVDLP 14
>gi|3891691|pdb|1BKH|B Chain B, Muconate Lactonizing Enzyme From Pseudomonas Putida Length = 361 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 3 IERI------DAIIVDLP 14
>gi|6730023|pdb|2MUC|A Chain A, Muconate Cycloisomerase Variant F329i gi|6730024|pdb|2MUC|B Chain B, Muconate Cycloisomerase Variant F329i Length = 373 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 6 IERI------DAIIVDLP 17
>gi|1942990|pdb|1OCC|E Chain E, Structure Of Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State gi|1943003|pdb|1OCC|R Chain R, Structure Of Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State gi|4389083|pdb|2OCC|E Chain E, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State gi|4389096|pdb|2OCC|R Chain R, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized State gi|5822142|pdb|1OCO|E Chain E, Bovine Heart Cytochrome C Oxidase In Carbon Monoxide-Bound State gi|5822155|pdb|1OCO|R Chain R, Bovine Heart Cytochrome C Oxidase In Carbon Monoxide-Bound State gi|5822168|pdb|1OCR|E Chain E, Bovine Heart Cytochrome C Oxidase In The Fully Reduced State gi|5822181|pdb|1OCR|R Chain R, Bovine Heart Cytochrome C Oxidase In The Fully Reduced State gi|5822194|pdb|1OCZ|E Chain E, Bovine Heart Cytochrome C Oxidase In Azide-Bound State gi|5822207|pdb|1OCZ|R Chain R, Bovine Heart Cytochrome C Oxidase In Azide-Bound State Length = 109 Score = 24.0 bits (49), Expect = 68 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 7/21 (33%) Query: 114 RA---LNKGKVDSASAVIILE 131 RA LN D ASAV ILE Sbjct: 53 RACRRLN----DFASAVRILE 69
>gi|1633161|pdb|1MUC|A Chain A, Structure Of Muconate Lactonizing Enzyme At 1.85 Angstroms Resolution gi|1633162|pdb|1MUC|B Chain B, Structure Of Muconate Lactonizing Enzyme At 1.85 Angstroms Resolution Length = 373 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 6 IERI------DAIIVDLP 17
>gi|3891690|pdb|1BKH|A Chain A, Muconate Lactonizing Enzyme From Pseudomonas Putida Length = 358 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 3 IERI------DAIIVDLP 14
>gi|13399452|pdb|1F9C|A Chain A, Crystal Structure Of Mle D178n Variant gi|13399453|pdb|1F9C|B Chain B, Crystal Structure Of Mle D178n Variant Length = 372 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 5 IERI------DAIIVDLP 16
>gi|6730035|pdb|3MUC|A Chain A, Muconate Cycloisomerase Variant I54v gi|6730036|pdb|3MUC|B Chain B, Muconate Cycloisomerase Variant I54v Length = 369 Score = 24.0 bits (49), Expect = 68 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 45 IERLLKEWQPDEIIVGLP 62 IER+ D IIV LP Sbjct: 3 IERI------DAIIVDLP 14
>gi|13399484|pdb|1G91|A Chain A, Solution Structure Of Myeloid Progenitor Inhibitory Factor- 1 (Mpif-1) Length = 77 Score = 23.5 bits (48), Expect = 91 Identities = 6/6 (100%), Positives = 6/6 (100%) Query: 130 LESYFE 135 LESYFE Sbjct: 25 LESYFE 30
>gi|28948572|pdb|1M3W|A Chain A, Crystal Structure Of A Molecular Maquette Scaffold gi|28948573|pdb|1M3W|B Chain B, Crystal Structure Of A Molecular Maquette Scaffold gi|28948574|pdb|1M3W|C Chain C, Crystal Structure Of A Molecular Maquette Scaffold gi|28948575|pdb|1M3W|D Chain D, Crystal Structure Of A Molecular Maquette Scaffold Length = 32 Score = 23.5 bits (48), Expect = 91 Identities = 6/7 (85%), Positives = 7/7 (100%) Query: 92 KLHDERL 98 KLH+ERL Sbjct: 22 KLHEERL 28
Score = 17.6 bits (34), Expect = 5563 Identities = 6/10 (60%), Positives = 8/10 (80%), Gaps = 1/10 (10%) Query: 88 GVEV-KLHDE 96 G E+ KLH+E Sbjct: 3 GGEIWKLHEE 12
>gi|21465645|pdb|1IRU|D Chain D, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution gi|21465659|pdb|1IRU|R Chain R, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 248 Score = 23.5 bits (48), Expect = 91 Identities = 10/18 (55%), Positives = 10/18 (55%), Gaps = 6/18 (33%) Query: 88 GVE----VKLHDERLSTV 101 GVE KL DER TV Sbjct: 44 GVEKKSVAKLQDER--TV 59
>gi|494456|pdb|1POW|A Chain A, Pyruvate Oxidase (E.C.1.2.3.3) (Wild Type) gi|494457|pdb|1POW|B Chain B, Pyruvate Oxidase (E.C.1.2.3.3) (Wild Type) Length = 585 Score = 23.5 bits (48), Expect = 91 Identities = 11/17 (64%), Positives = 11/17 (64%), Gaps = 4/17 (23%) Query: 18 AVGQRITGTARPLPAIK 34 AV ITG RPLPA K Sbjct: 534 AV---ITG-DRPLPAEK 546
>gi|494458|pdb|1POX|A Chain A, Pyruvate Oxidase (E.C.1.2.3.3) Mutant With Pro 178 Replaced By Ser, Ser 188 Replaced By Asn, And Ala 458 Replaced By Val (P178s,S188n,A458v) gi|494459|pdb|1POX|B Chain B, Pyruvate Oxidase (E.C.1.2.3.3) Mutant With Pro 178 Replaced By Ser, Ser 188 Replaced By Asn, And Ala 458 Replaced By Val (P178s,S188n,A458v) Length = 585 Score = 23.5 bits (48), Expect = 91 Identities = 11/17 (64%), Positives = 11/17 (64%), Gaps = 4/17 (23%) Query: 18 AVGQRITGTARPLPAIK 34 AV ITG RPLPA K Sbjct: 534 AV---ITG-DRPLPAEK 546
>gi|28373303|pdb|1GZ6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 gi|28373304|pdb|1GZ6|B Chain B, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 gi|28373305|pdb|1GZ6|C Chain C, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 gi|28373306|pdb|1GZ6|D Chain D, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 Length = 319 Score = 23.5 bits (48), Expect = 91 Identities = 5/7 (71%), Positives = 7/7 (100%) Query: 41 DWNIIER 47 DW+II+R Sbjct: 115 DWDIIQR 121
Score = 15.9 bits (30), Expect = 18032 Identities = 4/4 (100%), Positives = 4/4 (100%) Query: 106 GLFE 109 GLFE Sbjct: 235 GLFE 238
>gi|10835469|pdb|1FSK|B Chain B, Complex Formation Between A Fab Fragment Of A Monoclonal Igg Antibody And The Major Allergen From Birch Pollen Bet V 1 gi|10835472|pdb|1FSK|E Chain E, Complex Formation Between A Fab Fragment Of A Monoclonal Igg Antibody And The Major Allergen From Birch Pollen Bet V 1 gi|10835475|pdb|1FSK|H Chain H, Complex Formation Between A Fab Fragment Of A Monoclonal Igg Antibody And The Major Allergen From Birch Pollen Bet V 1 gi|10835478|pdb|1FSK|K Chain K, Complex Formation Between A Fab Fragment Of A Monoclonal Igg Antibody And The Major Allergen From Birch Pollen Bet V 1 Length = 214 Score = 23.5 bits (48), Expect = 91 Identities = 7/12 (58%), Positives = 11/12 (91%) Query: 13 KSIGVAVGQRIT 24 KS+ V+VG+R+T Sbjct: 9 KSMSVSVGERVT 20
>gi|4699811|pdb|1CEQ|A Chain A, Chloroquine Binds In The Cofactor Binding Site Of Plasmodium Falciparum Lactate Dehydrogenase. Length = 316 Score = 23.5 bits (48), Expect = 91 Identities = 8/15 (53%), Positives = 10/15 (66%), Gaps = 3/15 (20%) Query: 50 KEWQPDEIIVGLPLN 64 KEW D++ LPLN Sbjct: 91 KEWNRDDL---LPLN 102
>gi|3891377|pdb|1LTM| Accelerated X-Ray Structure Elucidation Of A 36 Kda MuramidaseTRANSGLYCOSYLASE USING WARP Length = 320 Score = 23.1 bits (47), Expect = 122 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 19/38 (50%) Query: 39 TPD--------WNIIE----RLLKEWQ----PDEIIVG 60 TPD WN E R WQ P EIIVG Sbjct: 82 TPDNVQNGVVFWNQYEDALNR---AWQVYGVPPEIIVG 116
>gi|3114282|pdb|1RYP|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution gi|3114296|pdb|1RYP|2 Chain 2, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution gi|11513425|pdb|1G65|M Chain M, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A Molecular Basis For Selectivity Of Alpha,Beta-Epoxyketone Proteasome Inhibitors gi|11513439|pdb|1G65|1 Chain 1, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A Molecular Basis For Selectivity Of Alpha,Beta-Epoxyketone Proteasome Inhibitors gi|14488818|pdb|1FNT|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution gi|14488832|pdb|1FNT|BB Chain b, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution gi|20150389|pdb|1JD2|M Chain M, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a Complex: A Non-Covalent Proteasome Inhibitor gi|20150396|pdb|1JD2|T Chain T, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a Complex: A Non-Covalent Proteasome Inhibitor Length = 233 Score = 23.1 bits (47), Expect = 122 Identities = 6/7 (85%), Positives = 7/7 (100%) Query: 45 IERLLKE 51 IERLLK+ Sbjct: 63 IERLLKD 69
>gi|1065365|pdb|1AMY| Alpha-1,4 Glycan-4-Glucanohydrolase (Alpha-Amylase, High Pi Isozyme (Amy2)) (E.C.3.2.1.1) gi|4699831|pdb|1AVA|A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed gi|4699832|pdb|1AVA|B Chain B, Amy2BASI PROTEIN-Protein Complex From Barley Seed gi|5542105|pdb|1BG9| Barley Alpha-Amylase With Substrate Analogue Acarbose Length = 403 Score = 23.1 bits (47), Expect = 122 Identities = 9/13 (69%), Positives = 9/13 (69%), Gaps = 1/13 (7%) Query: 8 FDFGTKSI-GVAV 19 FDF TK I VAV Sbjct: 244 FDFTTKGILNVAV 256
Score = 17.2 bits (33), Expect = 7464 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 8/28 (28%) Query: 119 GKVDS-ASAVII---L----ESYFEQGY 138 GKVD A+A I L +S EQGY Sbjct: 24 GKVDDIAAAGITHVWLPPASQSVAEQGY 51
>gi|22219179|pdb|1L1Y|A Chain A, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219180|pdb|1L1Y|B Chain B, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219181|pdb|1L1Y|C Chain C, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219182|pdb|1L1Y|D Chain D, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219183|pdb|1L1Y|E Chain E, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219184|pdb|1L1Y|F Chain F, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219185|pdb|1L2A|A Chain A, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219186|pdb|1L2A|B Chain B, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219187|pdb|1L2A|C Chain C, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219188|pdb|1L2A|D Chain D, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219189|pdb|1L2A|E Chain E, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome gi|22219190|pdb|1L2A|F Chain F, The Crystal Structure And Catalytic Mechanism Of Cellobiohydrolase Cels, The Major Enzymatic Component Of The Clostridium Thermocellum Cellulosome Length = 678 Score = 23.1 bits (47), Expect = 122 Identities = 11/30 (36%), Positives = 14/30 (46%), Gaps = 14/30 (46%) Query: 42 WNIIERLLKEWQPDEIIVGLPLNMDGTEQP 71 W ++E +W II P D TEQP Sbjct: 113 WKVME----DW----II---P---DSTEQP 128
Score = 16.3 bits (31), Expect = 13439 Identities = 6/8 (75%), Positives = 6/8 (75%) Query: 33 IKAQDGTP 40 I AQD TP Sbjct: 306 IGAQDKTP 313
>gi|14278167|pdb|1G0S|A Chain A, The Crystal Structure Of The E.Coli Adp-Ribose Pyrophosphatase gi|14278168|pdb|1G0S|B Chain B, The Crystal Structure Of The E.Coli Adp-Ribose Pyrophosphatase gi|14278187|pdb|1G9Q|A Chain A, Complex Structure Of The Adpr-Ase And Its Substrate Adp- Ribose gi|14278188|pdb|1G9Q|B Chain B, Complex Structure Of The Adpr-Ase And Its Substrate Adp- Ribose gi|14278189|pdb|1GA7|A Chain A, Crystal Structure Of The Adp-Ribose Pyrophosphatase In Complex With Gd+3 gi|14278190|pdb|1GA7|B Chain B, Crystal Structure Of The Adp-Ribose Pyrophosphatase In Complex With Gd+3 gi|24987472|pdb|1KHZ|A Chain A, Structure Of The Adpr-Ase In Complex With Ampcpr And Mg gi|24987473|pdb|1KHZ|B Chain B, Structure Of The Adpr-Ase In Complex With Ampcpr And Mg Length = 209 Score = 23.1 bits (47), Expect = 122 Identities = 7/13 (53%), Positives = 12/13 (92%) Query: 119 GKVDSASAVIILE 131 GK+D+A++VI L+ Sbjct: 183 GKIDNAASVIALQ 195
>gi|3114421|pdb|1ZAK|A Chain A, Adenylate Kinase From Maize In Complex With The Inhibitor P1,P5-Bis(Adenosine-5'-)pentaphosphate (Ap5a) gi|3114422|pdb|1ZAK|B Chain B, Adenylate Kinase From Maize In Complex With The Inhibitor P1,P5-Bis(Adenosine-5'-)pentaphosphate (Ap5a) Length = 222 Score = 23.1 bits (47), Expect = 122 Identities = 7/12 (58%), Positives = 8/12 (66%), Gaps = 4/12 (33%) Query: 54 PDEIIVGLPLNM 65 PDEI+V NM Sbjct: 65 PDEIVV----NM 72
>gi|17943083|pdb|1JGV|H Chain H, Structural Basis For Disfavored Elimination Reaction In Catalytic Antibody 1d4 Length = 218 Score = 23.1 bits (47), Expect = 122 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 7/18 (38%) Query: 90 EVKLHDERLSTVEARSGL 107 EVKL VE+R GL Sbjct: 1 EVKL-------VESRGGL 11
>gi|17943085|pdb|1JGU|H Chain H, Structural Basis For Disfavored Elimination Reaction In Catalytic Antibody 1d4 Length = 217 Score = 23.1 bits (47), Expect = 122 Identities = 9/18 (50%), Positives = 10/18 (55%), Gaps = 7/18 (38%) Query: 90 EVKLHDERLSTVEARSGL 107 EVKL VE+R GL Sbjct: 1 EVKL-------VESRGGL 11
>gi|10120773|pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes gi|10120774|pdb|1DC4|B Chain B, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Score = 23.1 bits (47), Expect = 122 Identities = 8/11 (72%), Positives = 8/11 (72%), Gaps = 2/11 (18%) Query: 84 HGRFG--VEVK 92 HGRF VEVK Sbjct: 50 HGRFDGTVEVK 60
Database: PDB protein database Posted date: Sep 27, 2003 8:18 PM Number of letters in database: 10,828,398 Number of sequences in database: 45,671 Lambda K H 0.340 0.286 1.73 Gapped Lambda K H 0.294 0.110 0.610 Matrix: PAM30 Gap Penalties: Existence: 9, Extension: 1 Number of Hits to DB: 467,475 Number of Sequences: 45671 Number of extensions: 44330 Number of successful extensions: 987 Number of sequences better than 20000.0: 784 Number of HSP's better than 20000.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of query: 138 length of database: 10,828,398 effective HSP length: 24 effective length of query: 114 effective length of database: 9,732,294 effective search space: 1109481516 effective search space used: 1109481516 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 35 (14.8 bits) X3: 58 (24.6 bits) S1: 30 (16.5 bits) S2: 30 (15.9 bits)
