Header of the page

BLASTP 2.2.6 [Apr-09-2003]

RID: 1064909311-8185-2884120.BLASTQ3

Query= T0134 Delta-adaptin appendage domain, human (251 letters)

Database: PDB protein database 45,671 sequences; 10,828,398 total letters Taxonomy reports

Distribution of 1 Blast Hits on the Query Sequence


Related Structures

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|5107616|pdb|1NSE|A  Chain A, Bovine Endothelial Nitric Ox...    29   2.2   Related structures
Alignments
>gi|5107616|pdb|1NSE|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase
 gi|5107617|pdb|1NSE|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase
 gi|5107729|pdb|2NSE|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Substrate Complex
 gi|5107731|pdb|2NSE|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Substrate Complex
 gi|5107748|pdb|3NSE|A  Related structures Chain A, Bovine Enos, H4b-Free, Seitu Complex
 gi|5107749|pdb|3NSE|B  Related structures Chain B, Bovine Enos, H4b-Free, Seitu Complex
 gi|5107770|pdb|4NSE|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase, H4b-Free, L-Arg
           Complex
 gi|5107772|pdb|4NSE|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase, H4b-Free, L-Arg
           Complex
 gi|11514281|pdb|1D1W|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 2-Aminothiazoline (H4b Bound)
 gi|11514282|pdb|1D1W|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 2-Aminothiazoline (H4b Bound)
 gi|11514311|pdb|1ED4|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With Ipitu (H4b Free)
 gi|11514312|pdb|1ED4|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With Ipitu (H4b Free)
 gi|11514334|pdb|9NSE|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase, Ethyl-
           Isoselenourea Complex
 gi|11514335|pdb|9NSE|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase, Ethyl-
           Isoselenourea Complex
 gi|12084335|pdb|1DMI|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 6s-H4b
 gi|12084336|pdb|1DMI|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 6s-H4b
 gi|12084337|pdb|1DMJ|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 5,6-Cyclic-Tetrahydropteridine
 gi|12084338|pdb|1DMJ|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 5,6-Cyclic-Tetrahydropteridine
 gi|12084339|pdb|1DMK|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 4-Amino-6-Phenyl-Tetrahydropteridine
 gi|12084340|pdb|1DMK|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 4-Amino-6-Phenyl-Tetrahydropteridine
 gi|12084442|pdb|1DM6|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With N-(4-Chlorophenyl)-N'-Hydroxyguanidine
           (H4b Free)
 gi|12084443|pdb|1DM6|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With N-(4-Chlorophenyl)-N'-Hydroxyguanidine
           (H4b Free)
 gi|12084444|pdb|1DM7|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With Homoarginine (H4b Free)
 gi|12084445|pdb|1DM7|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With Homoarginine (H4b Free)
 gi|12084446|pdb|1DM8|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 1,2,4-Triazole-Carboxamidine (H4b Bound)
 gi|12084447|pdb|1DM8|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 1,2,4-Triazole-Carboxamidine (H4b Bound)
 gi|13096230|pdb|1ED5|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With Nna(H4b Free)
 gi|13096231|pdb|1ED5|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With Nna(H4b Free)
 gi|13096232|pdb|1ED6|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With L-Nio (H4b Free)
 gi|13096233|pdb|1ED6|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With L-Nio (H4b Free)
 gi|15826051|pdb|1D1V|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With S-Ethyl-N-Phenyl-Isothiourea (H4b Bound)
 gi|15826052|pdb|1D1V|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With S-Ethyl-N-Phenyl-Isothiourea (H4b Bound)
 gi|15826053|pdb|1D1X|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 1,4-Pbitu (H4b Bound)
 gi|15826054|pdb|1D1X|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 1,4-Pbitu (H4b Bound)
 gi|15826055|pdb|1D1Y|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 1,3-Pbitu (H4b Free)
 gi|15826056|pdb|1D1Y|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 1,3-Pbitu (H4b Free)
 gi|15826104|pdb|1FOI|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 1400w(H4b-Free)
 gi|15826105|pdb|1FOI|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 1400w(H4b-Free)
 gi|15826106|pdb|1FOL|A  Related structures Chain A, Reduced Bovine Endothelial Nitric Oxide Synthase Heme
           Domain Complexed With L-Arg(H4b-Free)
 gi|15826107|pdb|1FOL|B  Related structures Chain B, Reduced Bovine Endothelial Nitric Oxide Synthase Heme
           Domain Complexed With L-Arg(H4b-Free)
 gi|15826108|pdb|1FOO|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With L-Arg And No(H4b-Free)
 gi|15826109|pdb|1FOO|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With L-Arg And No(H4b-Free)
 gi|15826110|pdb|1FOP|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With L-Arg And No(H4b-Bound)
 gi|15826111|pdb|1FOP|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With L-Arg And No(H4b-Bound)
 gi|17942659|pdb|1FOJ|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 7-Nitroindazole-2-Carboxamidine (H4b
           Present)
 gi|17942660|pdb|1FOJ|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 7-Nitroindazole-2-Carboxamidine (H4b
           Present)
 gi|17942669|pdb|8NSE|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase, Nna Complex
 gi|17942670|pdb|8NSE|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase, Nna Complex
 gi|17942712|pdb|1D0O|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 3-Bromo-7-Nitroindazole (H4b Present)
 gi|17942713|pdb|1D0O|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 3-Bromo-7-Nitroindazole (H4b Present)
 gi|17942714|pdb|1D0C|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 3-Bromo-7-Nitroindazole (H4b Free)
 gi|17942715|pdb|1D0C|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain
           Complexed With 3-Bromo-7-Nitroindazole (H4b Free)
 gi|21466143|pdb|5NSE|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase, H4b-Free,
           Hydroxy- Arg Complex
 gi|21466144|pdb|5NSE|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase, H4b-Free,
           Hydroxy- Arg Complex
 gi|21466145|pdb|6NSE|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase, H4b-Free,
           Canavanine Complex
 gi|21466146|pdb|6NSE|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase, H4b-Free,
           Canavanine Complex
 gi|21466147|pdb|7NSE|A  Related structures Chain A, Bovine Endothelial Nitric Oxide Synthase, H4b-Free, Adma
           Complex
 gi|21466148|pdb|7NSE|B  Related structures Chain B, Bovine Endothelial Nitric Oxide Synthase, H4b-Free, Adma
           Complex
          Length = 444

 Score = 28.9 bits (63), Expect = 2.2
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 159 LLESGDLSMSSIKVDGIRMSFQNLLAKICFHHHFSVVERVDSCASMYSRS 208
           LLE G L  S+    G  MS +     +C  H ++++E V  C  + +R+
Sbjct: 304 LLEIGGLEFSAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRT 353
  Database: PDB protein database
    Posted date:  Sep 27, 2003  8:18 PM
  Number of letters in database: 10,828,398
  Number of sequences in database:  45,671
  
Lambda     K      H
   0.316    0.131    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,537,961
Number of Sequences: 45671
Number of extensions: 55455
Number of successful extensions: 97
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 96
Number of HSP's gapped (non-prelim): 3
length of query: 251
length of database: 10,828,398
effective HSP length: 95
effective length of query: 156
effective length of database: 6,489,653
effective search space: 1012385868
effective search space used: 1012385868
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 58 (26.9 bits)