BLASTP 2.2.6 [Apr-09-2003]
RID: 1064909311-8185-2884120.BLASTQ3 Query= T0134 Delta-adaptin appendage domain, human (251 letters) Database: PDB protein database 45,671 sequences; 10,828,398 total letters Taxonomy reports
Query= T0134 Delta-adaptin appendage domain, human (251 letters)
Database: PDB protein database 45,671 sequences; 10,828,398 total letters Taxonomy reports
Related Structures Score E Sequences producing significant alignments: (bits) Value gi|5107616|pdb|1NSE|A Chain A, Bovine Endothelial Nitric Ox... 29 2.2 Alignments
Related Structures Score E Sequences producing significant alignments: (bits) Value gi|5107616|pdb|1NSE|A Chain A, Bovine Endothelial Nitric Ox... 29 2.2
>gi|5107616|pdb|1NSE|A Chain A, Bovine Endothelial Nitric Oxide Synthase gi|5107617|pdb|1NSE|B Chain B, Bovine Endothelial Nitric Oxide Synthase gi|5107729|pdb|2NSE|A Chain A, Bovine Endothelial Nitric Oxide Synthase Substrate Complex gi|5107731|pdb|2NSE|B Chain B, Bovine Endothelial Nitric Oxide Synthase Substrate Complex gi|5107748|pdb|3NSE|A Chain A, Bovine Enos, H4b-Free, Seitu Complex gi|5107749|pdb|3NSE|B Chain B, Bovine Enos, H4b-Free, Seitu Complex gi|5107770|pdb|4NSE|A Chain A, Bovine Endothelial Nitric Oxide Synthase, H4b-Free, L-Arg Complex gi|5107772|pdb|4NSE|B Chain B, Bovine Endothelial Nitric Oxide Synthase, H4b-Free, L-Arg Complex gi|11514281|pdb|1D1W|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 2-Aminothiazoline (H4b Bound) gi|11514282|pdb|1D1W|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 2-Aminothiazoline (H4b Bound) gi|11514311|pdb|1ED4|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With Ipitu (H4b Free) gi|11514312|pdb|1ED4|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With Ipitu (H4b Free) gi|11514334|pdb|9NSE|A Chain A, Bovine Endothelial Nitric Oxide Synthase, Ethyl- Isoselenourea Complex gi|11514335|pdb|9NSE|B Chain B, Bovine Endothelial Nitric Oxide Synthase, Ethyl- Isoselenourea Complex gi|12084335|pdb|1DMI|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 6s-H4b gi|12084336|pdb|1DMI|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 6s-H4b gi|12084337|pdb|1DMJ|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 5,6-Cyclic-Tetrahydropteridine gi|12084338|pdb|1DMJ|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 5,6-Cyclic-Tetrahydropteridine gi|12084339|pdb|1DMK|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 4-Amino-6-Phenyl-Tetrahydropteridine gi|12084340|pdb|1DMK|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 4-Amino-6-Phenyl-Tetrahydropteridine gi|12084442|pdb|1DM6|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With N-(4-Chlorophenyl)-N'-Hydroxyguanidine (H4b Free) gi|12084443|pdb|1DM6|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With N-(4-Chlorophenyl)-N'-Hydroxyguanidine (H4b Free) gi|12084444|pdb|1DM7|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With Homoarginine (H4b Free) gi|12084445|pdb|1DM7|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With Homoarginine (H4b Free) gi|12084446|pdb|1DM8|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 1,2,4-Triazole-Carboxamidine (H4b Bound) gi|12084447|pdb|1DM8|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 1,2,4-Triazole-Carboxamidine (H4b Bound) gi|13096230|pdb|1ED5|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With Nna(H4b Free) gi|13096231|pdb|1ED5|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With Nna(H4b Free) gi|13096232|pdb|1ED6|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With L-Nio (H4b Free) gi|13096233|pdb|1ED6|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With L-Nio (H4b Free) gi|15826051|pdb|1D1V|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With S-Ethyl-N-Phenyl-Isothiourea (H4b Bound) gi|15826052|pdb|1D1V|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With S-Ethyl-N-Phenyl-Isothiourea (H4b Bound) gi|15826053|pdb|1D1X|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 1,4-Pbitu (H4b Bound) gi|15826054|pdb|1D1X|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 1,4-Pbitu (H4b Bound) gi|15826055|pdb|1D1Y|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 1,3-Pbitu (H4b Free) gi|15826056|pdb|1D1Y|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 1,3-Pbitu (H4b Free) gi|15826104|pdb|1FOI|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 1400w(H4b-Free) gi|15826105|pdb|1FOI|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 1400w(H4b-Free) gi|15826106|pdb|1FOL|A Chain A, Reduced Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With L-Arg(H4b-Free) gi|15826107|pdb|1FOL|B Chain B, Reduced Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With L-Arg(H4b-Free) gi|15826108|pdb|1FOO|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With L-Arg And No(H4b-Free) gi|15826109|pdb|1FOO|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With L-Arg And No(H4b-Free) gi|15826110|pdb|1FOP|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With L-Arg And No(H4b-Bound) gi|15826111|pdb|1FOP|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With L-Arg And No(H4b-Bound) gi|17942659|pdb|1FOJ|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 7-Nitroindazole-2-Carboxamidine (H4b Present) gi|17942660|pdb|1FOJ|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 7-Nitroindazole-2-Carboxamidine (H4b Present) gi|17942669|pdb|8NSE|A Chain A, Bovine Endothelial Nitric Oxide Synthase, Nna Complex gi|17942670|pdb|8NSE|B Chain B, Bovine Endothelial Nitric Oxide Synthase, Nna Complex gi|17942712|pdb|1D0O|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 3-Bromo-7-Nitroindazole (H4b Present) gi|17942713|pdb|1D0O|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 3-Bromo-7-Nitroindazole (H4b Present) gi|17942714|pdb|1D0C|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 3-Bromo-7-Nitroindazole (H4b Free) gi|17942715|pdb|1D0C|B Chain B, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With 3-Bromo-7-Nitroindazole (H4b Free) gi|21466143|pdb|5NSE|A Chain A, Bovine Endothelial Nitric Oxide Synthase, H4b-Free, Hydroxy- Arg Complex gi|21466144|pdb|5NSE|B Chain B, Bovine Endothelial Nitric Oxide Synthase, H4b-Free, Hydroxy- Arg Complex gi|21466145|pdb|6NSE|A Chain A, Bovine Endothelial Nitric Oxide Synthase, H4b-Free, Canavanine Complex gi|21466146|pdb|6NSE|B Chain B, Bovine Endothelial Nitric Oxide Synthase, H4b-Free, Canavanine Complex gi|21466147|pdb|7NSE|A Chain A, Bovine Endothelial Nitric Oxide Synthase, H4b-Free, Adma Complex gi|21466148|pdb|7NSE|B Chain B, Bovine Endothelial Nitric Oxide Synthase, H4b-Free, Adma Complex Length = 444 Score = 28.9 bits (63), Expect = 2.2 Identities = 15/50 (30%), Positives = 25/50 (50%) Query: 159 LLESGDLSMSSIKVDGIRMSFQNLLAKICFHHHFSVVERVDSCASMYSRS 208 LLE G L S+ G MS + +C H ++++E V C + +R+ Sbjct: 304 LLEIGGLEFSAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRT 353
Database: PDB protein database Posted date: Sep 27, 2003 8:18 PM Number of letters in database: 10,828,398 Number of sequences in database: 45,671 Lambda K H 0.316 0.131 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,537,961 Number of Sequences: 45671 Number of extensions: 55455 Number of successful extensions: 97 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 96 Number of HSP's gapped (non-prelim): 3 length of query: 251 length of database: 10,828,398 effective HSP length: 95 effective length of query: 156 effective length of database: 6,489,653 effective search space: 1012385868 effective search space used: 1012385868 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 58 (26.9 bits)
