>gi|5107658|pdb|1QFJ|AChain A, Crystal Structure Of Nad(P)h:flavin Oxidoreductase From Escherichia Coli gi|5107659|pdb|1QFJ|B
Chain B, Crystal Structure Of Nad(P)h:flavin Oxidoreductase From Escherichia Coli gi|5107660|pdb|1QFJ|C
Chain C, Crystal Structure Of Nad(P)h:flavin Oxidoreductase From Escherichia Coli gi|5107661|pdb|1QFJ|D
Chain D, Crystal Structure Of Nad(P)h:flavin Oxidoreductase From Escherichia Coli Length = 232 Score = 37.1 bits (80), Expect = 0.019 Identities = 16/30 (53%), Positives = 17/30 (56%), Gaps = 12/30 (40%) Query: 258 PEAGEDLELKMGENWR-RTGTVLAAVKLED 286 PEAG WR RTGTVL AV L+D Sbjct: 170 PEAG----------WRGRTGTVLTAV-LQD 188
>gi|6435817|pdb|1B56|Human Recombinant Epidermal Fatty Acid Binding Protein gi|21730385|pdb|1JJJ|A
Chain A, Solution Structure Of Recombinant Human Epidermal-Type Fatty Acid Binding Protein Length = 135 Score = 29.5 bits (62), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Query: 283 KLEDGQVVVQVVMNN 297 KL+DG++VV+ VMNN Sbjct: 110 KLKDGKLVVECVMNN 124
>gi|21730147|pdb|1EA9|CChain C, Cyclomaltodextrinase gi|21730148|pdb|1EA9|D
Chain D, Cyclomaltodextrinase Length = 583 Score = 28.2 bits (59), Expect = 9.3 Identities = 17/35 (48%), Positives = 18/35 (51%), Gaps = 10/35 (28%) Query: 274 RTGTV--LAAVK-------L-EDGQVVVQVVMNND 298 RTGT L A K L ED Q + VVMNND Sbjct: 501 RTGTFKFLTAEKNSRQIAYLREDDQDTILVVMNND 535
>gi|10120640|pdb|1EIZ|AChain A, Ftsj Rna Methyltransferase Complexed With S- Adenosylmethionine gi|10120641|pdb|1EJ0|A
Chain A, Ftsj Rna Methyltransferase Complexed With S- Adenosylmethionine, Mercury Derivative Length = 180 Score = 27.4 bits (57), Expect = 17 Identities = 8/12 (66%), Positives = 10/12 (83%), Gaps = 1/12 (8%) Query: 291 VQVVMNNDMEPD 302 VQVVM +DM P+ Sbjct: 89 VQVVM-SDMAPN 99
>gi|34811079|pdb|1G3M|AChain A, Crystal Structure Of Human Estrogen Sulfotransferase In Complex With In-Active Cofactor Pap And 3,5,3',5'- Tetrachloro-Biphenyl-4,4'-Diol gi|34811080|pdb|1G3M|B
Chain B, Crystal Structure Of Human Estrogen Sulfotransferase In Complex With In-Active Cofactor Pap And 3,5,3',5'- Tetrachloro-Biphenyl-4,4'-Diol Length = 294 Score = 27.4 bits (57), Expect = 17 Identities = 7/8 (87%), Positives = 8/8 (100%) Query: 37 EKYMQGQV 44 EK+MQGQV Sbjct: 159 EKFMQGQV 166
Score = 17.6 bits (34), Expect = 14454
Identities = 5/7 (71%), Positives = 5/7 (71%)
Query: 119 VAGFQAR 125
V FQAR
Sbjct: 30 VEAFQAR 36
>gi|230599|pdb|2LDX|Apo-Lactate Dehydrogenase (E.C.1.1.1.27), Isoenzyme C4 Length = 331 Score = 27.4 bits (57), Expect = 17 Identities = 8/8 (100%), Positives = 8/8 (100%) Query: 173 TDKLRGEA 180 TDKLRGEA Sbjct: 54 TDKLRGEA 61
>gi|3891576|pdb|1AQU|AChain A, Estrogen Sulfotransferase With Bound Inactive Cofactor Pap And 17-Beta Estradiol gi|3891577|pdb|1AQU|B
Chain B, Estrogen Sulfotransferase With Bound Inactive Cofactor Pap And 17-Beta Estradiol gi|3891578|pdb|1AQY|A
Chain A, Estrogen Sulfotransferase With Pap gi|3891579|pdb|1AQY|B
Chain B, Estrogen Sulfotransferase With Pap gi|5821856|pdb|1BO6|A
Chain A, Estrogen Sulfotransferase With Inactive Cofactor Pap And Vanadate gi|5821857|pdb|1BO6|B
Chain B, Estrogen Sulfotransferase With Inactive Cofactor Pap And Vanadate Length = 297 Score = 27.4 bits (57), Expect = 17 Identities = 7/8 (87%), Positives = 8/8 (100%) Query: 37 EKYMQGQV 44 EK+MQGQV Sbjct: 162 EKFMQGQV 169
>gi|21730331|pdb|1HY3|AChain A, Crystal Structure Of Human Estrogen Sulfotransferase V269e Mutant In The Presence Of Paps gi|21730332|pdb|1HY3|B
Chain B, Crystal Structure Of Human Estrogen Sulfotransferase V269e Mutant In The Presence Of Paps Length = 294 Score = 27.4 bits (57), Expect = 17 Identities = 7/8 (87%), Positives = 8/8 (100%) Query: 37 EKYMQGQV 44 EK+MQGQV Sbjct: 159 EKFMQGQV 166
Score = 17.6 bits (34), Expect = 14454
Identities = 5/7 (71%), Positives = 5/7 (71%)
Query: 119 VAGFQAR 125
V FQAR
Sbjct: 30 VEAFQAR 36
>gi|494662|pdb|1TML|Crystal Structure Of The Catalytic Domain Of A Thermophilic Endocellulase Length = 286 Score = 26.9 bits (56), Expect = 22 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 14/29 (48%) Query: 198 PVIDA--------------ANSGQFIPQA 212 P+IDA A +GQF+PQA Sbjct: 250 PMIDAFLWIKLPGEADGCIAGAGQFVPQA 278
>gi|31615536|pdb|1LTX|AChain A, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 567 Score = 26.9 bits (56), Expect = 22 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 8/22 (36%) Query: 248 WLLAGSASRLPE---AGEDLEL 266 WLL SRLPE A E LEL Sbjct: 115 WLL----SRLPEPNWARE-LEL 131
Score = 18.0 bits (35), Expect = 10772
Identities = 5/7 (71%), Positives = 7/7 (100%)
Query: 32 TGADSEK 38
TG+DS+K
Sbjct: 323 TGSDSQK 329
>gi|15826812|pdb|1H6V|AChain A, Mammalian Thioredoxin Reductase gi|15826813|pdb|1H6V|B
Chain B, Mammalian Thioredoxin Reductase gi|15826814|pdb|1H6V|C
Chain C, Mammalian Thioredoxin Reductase gi|15826815|pdb|1H6V|D
Chain D, Mammalian Thioredoxin Reductase gi|15826816|pdb|1H6V|E
Chain E, Mammalian Thioredoxin Reductase gi|15826817|pdb|1H6V|F
Chain F, Mammalian Thioredoxin Reductase Length = 499 Score = 26.9 bits (56), Expect = 22 Identities = 8/10 (80%), Positives = 8/10 (80%) Query: 157 AERFLIVTDE 166 AERFLI T E Sbjct: 154 AERFLIATGE 163
>gi|7546395|pdb|1DCE|AChain A, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain gi|7546397|pdb|1DCE|C
Chain C, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 567 Score = 26.9 bits (56), Expect = 22 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 8/22 (36%) Query: 248 WLLAGSASRLPE---AGEDLEL 266 WLL SRLPE A E LEL Sbjct: 115 WLL----SRLPEPNWARE-LEL 131
Score = 18.0 bits (35), Expect = 10772
Identities = 5/7 (71%), Positives = 7/7 (100%)
Query: 32 TGADSEK 38
TG+DS+K
Sbjct: 323 TGSDSQK 329
>gi|229953|pdb|1GPD|GChain G, D-Glyceraldehyde-3-Phosphate Dehydrogenase (E.C.1.2.1.12) gi|229954|pdb|1GPD|R
Chain R, D-Glyceraldehyde-3-Phosphate Dehydrogenase (E.C.1.2.1.12) Length = 334 Score = 26.5 bits (55), Expect = 30 Identities = 11/26 (42%), Positives = 19/26 (73%), Gaps = 3/26 (11%) Query: 282 VKLEDGQVVVQ---VVMNNDMEPDSI 304 VK+EDG +VV + + N+M+P++I Sbjct: 57 VKMEDGALVVDGKKITVFNEMKPENI 82
>gi|231017|pdb|4GPD|1Chain 1, Apo-D-Gyceraldehyde-3-Phosphate Dehydrogenase (E.C.1.2.1.12) gi|231018|pdb|4GPD|2
Chain 2, Apo-D-Gyceraldehyde-3-Phosphate Dehydrogenase (E.C.1.2.1.12) gi|231019|pdb|4GPD|3
Chain 3, Apo-D-Gyceraldehyde-3-Phosphate Dehydrogenase (E.C.1.2.1.12) gi|231020|pdb|4GPD|4
Chain 4, Apo-D-Gyceraldehyde-3-Phosphate Dehydrogenase (E.C.1.2.1.12) Length = 333 Score = 26.5 bits (55), Expect = 30 Identities = 11/26 (42%), Positives = 19/26 (73%), Gaps = 3/26 (11%) Query: 282 VKLEDGQVVVQ---VVMNNDMEPDSI 304 VK+EDG +VV + + N+M+P++I Sbjct: 56 VKMEDGALVVDGKKITVFNEMKPENI 81
>gi|31615597|pdb|1N1Q|AChain A, Crystal Structure Of A Dps Protein From Bacillus Brevis gi|31615598|pdb|1N1Q|B
Chain B, Crystal Structure Of A Dps Protein From Bacillus Brevis gi|31615599|pdb|1N1Q|C
Chain C, Crystal Structure Of A Dps Protein From Bacillus Brevis gi|31615600|pdb|1N1Q|D
Chain D, Crystal Structure Of A Dps Protein From Bacillus Brevis Length = 149 Score = 26.5 bits (55), Expect = 30 Identities = 7/8 (87%), Positives = 8/8 (100%) Query: 165 DEATANML 172 DEATA+ML Sbjct: 123 DEATADML 130
>gi|14278324|pdb|1I3Q|AChain A, Rna Polymerase Ii Crystal Form I At 3.1 A Resolution gi|14278335|pdb|1I50|A
Chain A, Rna Polymerase Ii Crystal Form Ii At 2.8 A Resolution gi|14278365|pdb|1I6H|A
Chain A, Rna Polymerase Ii Elongation Complex gi|20150713|pdb|1K83|A
Chain A, Crystal Structure Of Yeast Rna Polymerase Ii Complexed With The Inhibitor Alpha Amanitin gi|30749616|pdb|1NIK|A
Chain A, Wild Type Rna Polymerase Ii gi|30749737|pdb|1NT9|A
Chain A, Complete 12-Subunit Rna Polymerase Ii gi|34810553|pdb|1PQV|A
Chain A, Rna Polymerase Ii-Tfiis Complex Length = 1733 Score = 26.1 bits (54), Expect = 40 Identities = 11/19 (57%), Positives = 12/19 (63%), Gaps = 4/19 (21%) Query: 163 VTDEATANMLTDK----LR 177 VT EA AN+LT K LR Sbjct: 693 VTKEAQANLLTAKHGMTLR 711
>gi|15826661|pdb|1FO6|AChain A, Crystal Structure Analysis Of N-Carbamoyl-D-Amino-Acid Amidohydrolase gi|15826662|pdb|1FO6|B
Chain B, Crystal Structure Analysis Of N-Carbamoyl-D-Amino-Acid Amidohydrolase gi|15826663|pdb|1FO6|C
Chain C, Crystal Structure Analysis Of N-Carbamoyl-D-Amino-Acid Amidohydrolase gi|15826664|pdb|1FO6|D
Chain D, Crystal Structure Analysis Of N-Carbamoyl-D-Amino-Acid Amidohydrolase Length = 304 Score = 26.1 bits (54), Expect = 40 Identities = 10/16 (62%), Positives = 11/16 (68%), Gaps = 2/16 (12%) Query: 196 GFPV--IDAANSGQFI 209 GFPV +DAA G FI Sbjct: 156 GFPVYDVDAAKMGMFI 171
>gi|2624812|pdb|1FUI|AChain A, L-Fucose Isomerase From Escherichia Coli gi|2624813|pdb|1FUI|B
Chain B, L-Fucose Isomerase From Escherichia Coli gi|2624814|pdb|1FUI|C
Chain C, L-Fucose Isomerase From Escherichia Coli gi|2624815|pdb|1FUI|D
Chain D, L-Fucose Isomerase From Escherichia Coli gi|2624816|pdb|1FUI|E
Chain E, L-Fucose Isomerase From Escherichia Coli gi|2624817|pdb|1FUI|F
Chain F, L-Fucose Isomerase From Escherichia Coli Length = 591 Score = 26.1 bits (54), Expect = 40 Identities = 8/11 (72%), Positives = 10/11 (90%) Query: 167 ATANMLTDKLR 177 ATA +LT+KLR Sbjct: 36 ATAALLTEKLR 46
>gi|14278688|pdb|1ERZ|AChain A, Crystal Structure Of N-Carbamyl-D-Amino Acid Amidohydrolase With A Novel Catalytic Framework Common To Amidohydrolases gi|14278689|pdb|1ERZ|B
Chain B, Crystal Structure Of N-Carbamyl-D-Amino Acid Amidohydrolase With A Novel Catalytic Framework Common To Amidohydrolases Length = 303 Score = 26.1 bits (54), Expect = 40 Identities = 10/16 (62%), Positives = 11/16 (68%), Gaps = 2/16 (12%) Query: 196 GFPV--IDAANSGQFI 209 GFPV +DAA G FI Sbjct: 155 GFPVYDVDAAKMGMFI 170
>gi|21465840|pdb|1KIC|AChain A, Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma Vivax: Asp10ala Mutant In Complex With Inosine gi|21465841|pdb|1KIC|B
Chain B, Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma Vivax: Asp10ala Mutant In Complex With Inosine gi|21465842|pdb|1KIE|A
Chain A, Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma Vivax: Asp10ala Mutant In Complex With 3- Deaza-Adenosine gi|21465843|pdb|1KIE|B
Chain B, Inosine-Adenosine-Guanosine Preferring Nucleoside Hydrolase From Trypanosoma Vivax: Asp10ala Mutant In Complex With 3- Deaza-Adenosine Length = 339 Score = 25.7 bits (53), Expect = 54 Identities = 10/24 (41%), Positives = 12/24 (50%), Gaps = 11/24 (45%) Query: 61 HCDAKGKMWSNLRLFRDGDG-FAW 83 HC+ L RDGDG +AW Sbjct: 259 HCE----------LLRDGDGYYAW 272
>gi|999590|pdb|1PLQ|Proliferating Cell Nuclear Antigen (Pcna) (Synchrotron X-Ray Diffraction) gi|999599|pdb|1PLR|
Proliferating Cell Nuclear Antigen (Pcna) Length = 258 Score = 25.7 bits (53), Expect = 54 Identities = 10/18 (55%), Positives = 10/18 (55%), Gaps = 5/18 (27%) Query: 111 DDERVLL-----GVAGFQ 123 DD RVLL GV FQ Sbjct: 41 DDSRVLLVSLEIGVEAFQ 58
Score = 17.2 bits (33), Expect = 19394
Identities = 7/12 (58%), Positives = 8/12 (66%)
Query: 310 DANTLHIEPLPY 321
DA+ L IE L Y
Sbjct: 122 DADFLKIEELQY 133
>gi|17943413|pdb|1HP0|AChain A, Crystal Structure Of An Inosine-Adenosine-Guanosine- Preferring Nucleoside Hydrolase From Trypanosoma Vivax In Complex With The Substrate Analogue 3-Deaza-Adenosine gi|17943414|pdb|1HP0|B
Chain B, Crystal Structure Of An Inosine-Adenosine-Guanosine- Preferring Nucleoside Hydrolase From Trypanosoma Vivax In Complex With The Substrate Analogue 3-Deaza-Adenosine gi|17943415|pdb|1HOZ|A
Chain A, Crystal Structure Of An Inosine-Adenosine-Guanosine- Preferring Nucleoside Hydrolase From Trypanosoma Vivax gi|17943416|pdb|1HOZ|B
Chain B, Crystal Structure Of An Inosine-Adenosine-Guanosine- Preferring Nucleoside Hydrolase From Trypanosoma Vivax Length = 339 Score = 25.7 bits (53), Expect = 54 Identities = 10/24 (41%), Positives = 12/24 (50%), Gaps = 11/24 (45%) Query: 61 HCDAKGKMWSNLRLFRDGDG-FAW 83 HC+ L RDGDG +AW Sbjct: 259 HCE----------LLRDGDGYYAW 272
>gi|21465695|pdb|1J96|AChain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone gi|21465696|pdb|1J96|B
Chain B, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 Score = 25.2 bits (52), Expect = 73 Identities = 9/13 (69%), Positives = 10/13 (76%) Query: 191 LNIEAGFPVIDAA 203 L IEAGF ID+A Sbjct: 40 LAIEAGFHHIDSA 52
Score = 18.0 bits (35), Expect = 10772
Identities = 4/5 (80%), Positives = 5/5 (100%)
Query: 67 KMWSN 71
K+WSN
Sbjct: 84 KLWSN 88
Score = 17.6 bits (34), Expect = 14454
Identities = 5/7 (71%), Positives = 5/7 (71%)
Query: 282 VKLEDGQ 288
VKL DG
Sbjct: 8 VKLNDGH 14
>gi|3891426|pdb|1BHE|Polygalacturonase From Erwinia Carotovora Ssp. Carotovora Length = 376 Score = 25.2 bits (52), Expect = 73 Identities = 8/10 (80%), Positives = 8/10 (80%), Gaps = 1/10 (10%) Query: 75 FRDGDGF-AW 83 F DGDGF AW Sbjct: 179 FSDGDGFTAW 188
>gi|22218774|pdb|1IHX|AChain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry gi|22218775|pdb|1IHX|B
Chain B, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry gi|22218776|pdb|1IHX|C
Chain C, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry gi|22218777|pdb|1IHX|D
Chain D, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry gi|22218778|pdb|1IHY|A
Chain A, Gapdh Complexed With Adp-Ribose gi|22218779|pdb|1IHY|B
Chain B, Gapdh Complexed With Adp-Ribose gi|22218780|pdb|1IHY|C
Chain C, Gapdh Complexed With Adp-Ribose gi|22218781|pdb|1IHY|D
Chain D, Gapdh Complexed With Adp-Ribose Length = 333 Score = 25.2 bits (52), Expect = 73 Identities = 11/26 (42%), Positives = 19/26 (73%), Gaps = 3/26 (11%) Query: 282 VKLEDGQVVVQ---VVMNNDMEPDSI 304 VK+EDG +VV + + N+M+P++I Sbjct: 56 VKVEDGALVVDGKKITVFNEMKPENI 81
>gi|15988013|pdb|1IHI|AChain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate gi|15988014|pdb|1IHI|B
Chain B, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 Score = 25.2 bits (52), Expect = 73 Identities = 9/13 (69%), Positives = 10/13 (76%) Query: 191 LNIEAGFPVIDAA 203 L IEAGF ID+A Sbjct: 40 LAIEAGFHHIDSA 52
Score = 18.0 bits (35), Expect = 10772
Identities = 4/5 (80%), Positives = 5/5 (100%)
Query: 67 KMWSN 71
K+WSN
Sbjct: 84 KLWSN 88
Score = 17.6 bits (34), Expect = 14454
Identities = 5/7 (71%), Positives = 5/7 (71%)
Query: 282 VKLEDGQ 288
VKL DG
Sbjct: 8 VKLNDGH 14
>gi|809177|pdb|1AGX|Glutaminase-Asparaginase (E.C.3.5.1.1) Length = 331 Score = 24.8 bits (51), Expect = 98 Identities = 10/19 (52%), Positives = 11/19 (57%), Gaps = 5/19 (26%) Query: 291 VQVVMNNDMEPDSIFRVRD 309 V V+MN DSIF RD Sbjct: 149 VMVLMN-----DSIFAARD 162
>gi|33357758|pdb|1OIA|AChain A, U1a Rnp Domain 1-95 gi|33357759|pdb|1OIA|B
Chain B, U1a Rnp Domain 1-95 Length = 95 Score = 24.8 bits (51), Expect = 98 Identities = 8/11 (72%), Positives = 9/11 (81%), Gaps = 2/11 (18%) Query: 96 ELKK--YAVFS 104 ELKK YA+FS Sbjct: 25 ELKKSLYAIFS 35
>gi|1633231|pdb|1FHT|Rna-Binding Domain Of The U1a Spliceosomal Protein U1a117, Nmr, 43 Structures Length = 116 Score = 24.8 bits (51), Expect = 98 Identities = 8/11 (72%), Positives = 9/11 (81%), Gaps = 2/11 (18%) Query: 96 ELKK--YAVFS 104 ELKK YA+FS Sbjct: 24 ELKKSLYAIFS 34
>gi|3660233|pdb|1M6C|AChain A, V68n Myoglobin With Co gi|3660234|pdb|1M6C|B
Chain B, V68n Myoglobin With Co gi|3660235|pdb|1M6M|A
Chain A, V68n Met Myoglobin gi|3660236|pdb|1M6M|B
Chain B, V68n Met Myoglobin gi|3660237|pdb|1MDN|A
Chain A, Wild Type Myoglobin With Co gi|3660238|pdb|1MDN|B
Chain B, Wild Type Myoglobin With Co gi|3660242|pdb|1MNO|A
Chain A, V68n Myoglobin Oxy Form gi|3660243|pdb|1MNO|B
Chain B, V68n Myoglobin Oxy Form Length = 153 Score = 24.8 bits (51), Expect = 98 Identities = 10/13 (76%), Positives = 10/13 (76%), Gaps = 1/13 (7%) Query: 213 TNLQALGGISFKK 225 TNL ALGGI KK Sbjct: 67 TNLTALGGI-LKK 78
>gi|29726311|pdb|1J19|BChain B, Crystal Structure Of The Radxin Ferm Domain Complexed With The Icam-2 Cytoplasmic Peptide Length = 16 Score = 24.8 bits (51), Expect = 98 Identities = 9/11 (81%), Positives = 9/11 (81%), Gaps = 2/11 (18%) Query: 273 RRTGT--VLAA 281 RRTGT VLAA Sbjct: 2 RRTGTYGVLAA 12
>gi|33357049|pdb|1I6X|AChain A, Structure Of A Star Mutant Crp-Camp At 2.2 A gi|33357050|pdb|1I6X|B
Chain B, Structure Of A Star Mutant Crp-Camp At 2.2 A Length = 209 Score = 24.4 bits (50), Expect = 131 Identities = 7/11 (63%), Positives = 10/11 (90%) Query: 51 MAEDQHLLAAH 61 M EDQ+L++AH Sbjct: 189 MLEDQNLISAH 199
>gi|230390|pdb|1VSG|AChain A, Variant Surface Glycoprotein (N-Terminal Domain) gi|230391|pdb|1VSG|B
Chain B, Variant Surface Glycoprotein (N-Terminal Domain) Length = 364 Score = 24.4 bits (50), Expect = 131 Identities = 8/10 (80%), Positives = 8/10 (80%), Gaps = 2/10 (20%) Query: 95 TELKKYAVFS 104 TELKKY FS Sbjct: 295 TELKKY--FS 302
>gi|13096634|pdb|1HW5|AChain A, The CapCRP VARIANT T127LS128A gi|13096635|pdb|1HW5|B
Chain B, The CapCRP VARIANT T127LS128A Length = 210 Score = 24.4 bits (50), Expect = 131 Identities = 7/11 (63%), Positives = 10/11 (90%) Query: 51 MAEDQHLLAAH 61 M EDQ+L++AH Sbjct: 190 MLEDQNLISAH 200
>gi|1310766|pdb|1VAS|AChain A, Mol_id: 1; Molecule: Endonuclease V; Chain: A; Ec: 3.1.25.1; Engineered: Yes; Mutation: E23q; Mol_id: 2; Molecule: Dna (5'-D(ApTpCpGpCpGpTpTpGpCpGpCpT)-3') (Dot) (5'-D(TpApGpCpGpCpApApCpGpCpGpA)-3'); Chain: B, C; Engineered: Yes Length = 137 Score = 24.4 bits (50), Expect = 131 Identities = 8/12 (66%), Positives = 11/12 (91%), Gaps = 1/12 (8%) Query: 48 VSQMAEDQHLLA 59 VS++A DQHL+A Sbjct: 8 VSELA-DQHLMA 18
>gi|15826319|pdb|1HR6|AChain A, Yeast Mitochondrial Processing Peptidase gi|15826321|pdb|1HR6|C
Chain C, Yeast Mitochondrial Processing Peptidase gi|15826323|pdb|1HR6|E
Chain E, Yeast Mitochondrial Processing Peptidase gi|15826325|pdb|1HR6|G
Chain G, Yeast Mitochondrial Processing Peptidase gi|15826327|pdb|1HR7|A
Chain A, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant gi|15826329|pdb|1HR7|C
Chain C, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant gi|15826331|pdb|1HR7|E
Chain E, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant gi|15826333|pdb|1HR7|G
Chain G, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant gi|15826335|pdb|1HR8|A
Chain A, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Cytochrome C Oxidase Iv Signal Peptide gi|15826337|pdb|1HR8|C
Chain C, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Cytochrome C Oxidase Iv Signal Peptide gi|15826339|pdb|1HR8|E
Chain E, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Cytochrome C Oxidase Iv Signal Peptide gi|15826341|pdb|1HR8|G
Chain G, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Cytochrome C Oxidase Iv Signal Peptide gi|15826347|pdb|1HR9|A
Chain A, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Malate Dehydrogenase Signal Peptide gi|15826349|pdb|1HR9|C
Chain C, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Malate Dehydrogenase Signal Peptide gi|15826351|pdb|1HR9|E
Chain E, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Malate Dehydrogenase Signal Peptide gi|15826353|pdb|1HR9|G
Chain G, Yeast Mitochondrial Processing Peptidase Beta-E73q Mutant Complexed With Malate Dehydrogenase Signal Peptide Length = 475 Score = 24.4 bits (50), Expect = 131 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 17/40 (42%) Query: 282 VKLED-GQVVVQVVMN------NDM----E---PDSIFRV 307 V+LED G+ QV+M+ N+M E PD I RV Sbjct: 374 VELEDMGR---QVLMHGRKIPVNEMISKIEDLKPDDISRV 410
>gi|640375|pdb|1ENI|Endonuclease V (E.C.3.1.25.1) Mutant With Arg 3 Replaced By Gln (R3q) Length = 138 Score = 24.4 bits (50), Expect = 131 Identities = 8/12 (66%), Positives = 11/12 (91%), Gaps = 1/12 (8%) Query: 48 VSQMAEDQHLLA 59 VS++A DQHL+A Sbjct: 9 VSELA-DQHLMA 19
>gi|28948507|pdb|1M0U|AChain A, Crystal Structure Of The Drosophila Glutathione S- Transferase-2 In Complex With Glutathione gi|28948508|pdb|1M0U|B
Chain B, Crystal Structure Of The Drosophila Glutathione S- Transferase-2 In Complex With Glutathione Length = 249 Score = 24.4 bits (50), Expect = 131 Identities = 7/10 (70%), Positives = 8/10 (80%) Query: 82 AWIERRSVRE 91 AWIE+R V E Sbjct: 239 AWIEKRPVTE 248
>gi|640377|pdb|1ENK|Endonuclease V (E.C.3.1.25.1) Mutant With Glu 23 Replaced By Asp (E23d) Length = 138 Score = 24.4 bits (50), Expect = 131 Identities = 8/12 (66%), Positives = 11/12 (91%), Gaps = 1/12 (8%) Query: 48 VSQMAEDQHLLA 59 VS++A DQHL+A Sbjct: 9 VSELA-DQHLMA 19
>gi|2392158|pdb|1AJS|AChain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Score = 24.4 bits (50), Expect = 131 Identities = 7/8 (87%), Positives = 7/8 (87%) Query: 300 EPDSIFRV 307 EPDSI RV Sbjct: 276 EPDSILRV 283
>gi|2981968|pdb|1FGJ|AChain A, X-Ray Structure Of Hydroxylamine Oxidoreductase gi|2981969|pdb|1FGJ|B
Chain B, X-Ray Structure Of Hydroxylamine Oxidoreductase Length = 546 Score = 24.4 bits (50), Expect = 131 Identities = 8/11 (72%), Positives = 8/11 (72%), Gaps = 3/11 (27%) Query: 264 LELK---MGEN 271 LELK MGEN Sbjct: 438 LELKVLEMGEN 448
>gi|30749829|pdb|1O3S|AChain A, Protein-Dna Recognition And Dna Deformation Revealed In Crystal Structures Of Cap-Dna Complexes Length = 200 Score = 24.4 bits (50), Expect = 131 Identities = 7/11 (63%), Positives = 10/11 (90%) Query: 51 MAEDQHLLAAH 61 M EDQ+L++AH Sbjct: 182 MLEDQNLISAH 192
>gi|27065480|pdb|1LWD|AChain A, Crystal Structure Of Nadp-Dependent Isocitrate Dehydrogenase From Porcine Heart Mitochondria gi|27065481|pdb|1LWD|B
Chain B, Crystal Structure Of Nadp-Dependent Isocitrate Dehydrogenase From Porcine Heart Mitochondria Length = 413 Score = 24.4 bits (50), Expect = 131 Identities = 10/18 (55%), Positives = 12/18 (66%), Gaps = 1/18 (5%) Query: 99 KYAVFSK-VTIAPDDERV 115 KY+V K TI PD+ RV Sbjct: 67 KYSVAVKCATITPDEARV 84
>gi|1633518|pdb|1RCP|AChain A, Cytochrome C' gi|1633519|pdb|1RCP|B
Chain B, Cytochrome C' gi|1827746|pdb|1NBB|A
Chain A, N-Butylisocyanide Bound Rhodobacter Capsulatus Cytochrome C' gi|1827747|pdb|1NBB|B
Chain B, N-Butylisocyanide Bound Rhodobacter Capsulatus Cytochrome C' gi|1943028|pdb|1CPQ|
Cytochrome C' From Rhodopseudomonas Capsulata Length = 129 Score = 24.4 bits (50), Expect = 131 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 6/30 (20%) Query: 194 EAGFPVIDAANSGQ---FIPQATNLQALGG 220 EAG VI AAN+G F LQ LGG Sbjct: 90 EAGGAVIAAANAGDGAAF---GAALQKLGG 116
>gi|7767231|pdb|2CGP|AChain A, Catabolite Gene Activator ProteinDNA COMPLEX, ADENOSINE-3', 5'-Cyclic-Monophosphate gi|12084394|pdb|1G6N|A
Chain A, 2.1 Angstrom Structure Of Cap-Camp gi|12084395|pdb|1G6N|B
Chain B, 2.1 Angstrom Structure Of Cap-Camp Length = 210 Score = 24.4 bits (50), Expect = 131 Identities = 7/11 (63%), Positives = 10/11 (90%) Query: 51 MAEDQHLLAAH 61 M EDQ+L++AH Sbjct: 190 MLEDQNLISAH 200
>gi|1942960|pdb|1RGS|Regulatory Subunit Of Camp Dependent Protein Kinase Length = 288 Score = 24.4 bits (50), Expect = 131 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 4/20 (20%) Query: 277 TV---LAAVKLEDGQ-VVVQ 292 TV L V+ EDGQ +VVQ Sbjct: 173 TVADALEPVQFEDGQKIVVQ 192
>gi|30749823|pdb|1O3Q|AChain A, Protein-Dna Recognition And Dna Deformation Revealed In Crystal Structures Of Cap-Dna Complexes gi|30749826|pdb|1O3R|A
Chain A, Protein-Dna Recognition And Dna Deformation Revealed In Crystal Structures Of Cap-Dna Complexes gi|30749832|pdb|1O3T|A
Chain A, Protein-Dna Recognition And Dna Deformation Revealed In Crystal Structures Of Cap-Dna Complexes gi|30749833|pdb|1O3T|B
Chain B, Protein-Dna Recognition And Dna Deformation Revealed In Crystal Structures Of Cap-Dna Complexes Length = 200 Score = 24.4 bits (50), Expect = 131 Identities = 7/11 (63%), Positives = 10/11 (90%) Query: 51 MAEDQHLLAAH 61 M EDQ+L++AH Sbjct: 182 MLEDQNLISAH 192
>gi|7546519|pdb|1EKY|AChain A, Model Structure From Non-Noe Based Nmr Structure Calculation Length = 129 Score = 24.4 bits (50), Expect = 131 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 6/30 (20%) Query: 194 EAGFPVIDAANSGQ---FIPQATNLQALGG 220 EAG VI AAN+G F LQ LGG Sbjct: 90 EAGGAVIAAANAGDGAAF---GAALQKLGG 116
>gi|640376|pdb|1ENJ|Endonuclease V (E.C.3.1.25.1) Mutant With Glu 23 Replaced By Gln (E23q) Length = 138 Score = 24.4 bits (50), Expect = 131 Identities = 8/12 (66%), Positives = 11/12 (91%), Gaps = 1/12 (8%) Query: 48 VSQMAEDQHLLA 59 VS++A DQHL+A Sbjct: 9 VSELA-DQHLMA 19
>gi|3891967|pdb|1AY4|AChain A, Aromatic Amino Acid Aminotransferase Without Substrate gi|3891968|pdb|1AY4|B
Chain B, Aromatic Amino Acid Aminotransferase Without Substrate gi|3891969|pdb|1AY5|A
Chain A, Aromatic Amino Acid Aminotransferase Complex With Maleate gi|3891970|pdb|1AY5|B
Chain B, Aromatic Amino Acid Aminotransferase Complex With Maleate gi|3891971|pdb|1AY8|A
Chain A, Aromatic Amino Acid Aminotransferase Complex With 3-Phenylpropionate gi|3891972|pdb|1AY8|B
Chain B, Aromatic Amino Acid Aminotransferase Complex With 3-Phenylpropionate gi|4388901|pdb|2AY1|A
Chain A, Aromatic Amino Acid Aminotransferase With 4-Aminohydrocinnamic Acid gi|4388902|pdb|2AY1|B
Chain B, Aromatic Amino Acid Aminotransferase With 4-Aminohydrocinnamic Acid gi|4388903|pdb|2AY2|A
Chain A, Aromatic Amino Acid Aminotransferase With Cyclohexane Propionic Acid gi|4388904|pdb|2AY2|B
Chain B, Aromatic Amino Acid Aminotransferase With Cyclohexane Propionic Acid gi|4388905|pdb|2AY3|A
Chain A, Aromatic Amino Acid Aminotransferase With 3-(3,4-Dimethoxyphenyl)propionic Acid gi|4388906|pdb|2AY3|B
Chain B, Aromatic Amino Acid Aminotransferase With 3-(3,4-Dimethoxyphenyl)propionic Acid gi|4388907|pdb|2AY4|A
Chain A, Aromatic Amino Acid Aminotransferase With 3-(P-Tolyl)propionic Acid gi|4388908|pdb|2AY4|B
Chain B, Aromatic Amino Acid Aminotransferase With 3-(P-Tolyl)propionic Acid gi|4388909|pdb|2AY5|A
Chain A, Aromatic Amino Acid Aminotransferase With 3-Indolepropionic Acid gi|4388910|pdb|2AY5|B
Chain B, Aromatic Amino Acid Aminotransferase With 3-Indolepropionic Acid gi|4388911|pdb|2AY6|A
Chain A, Aromatic Amino Acid Aminotransferase With 3-Indolebutyric Acid gi|4388912|pdb|2AY6|B
Chain B, Aromatic Amino Acid Aminotransferase With 3-Indolebutyric Acid gi|4388913|pdb|2AY7|A
Chain A, Aromatic Amino Acid Aminotransferase With 4-Phenylbutyric Acid gi|4388914|pdb|2AY7|B
Chain B, Aromatic Amino Acid Aminotransferase With 4-Phenylbutyric Acid gi|4388915|pdb|2AY8|A
Chain A, Aromatic Amino Acid Aminotransferase With 4-(2-Thienyl)butyric Acid gi|4388916|pdb|2AY8|B
Chain B, Aromatic Amino Acid Aminotransferase With 4-(2-Thienyl)butyric Acid gi|4388917|pdb|2AY9|A
Chain A, Aromatic Amino Acid Aminotransferase With 5-Phenylvaleric Acid gi|4388918|pdb|2AY9|B
Chain B, Aromatic Amino Acid Aminotransferase With 5-Phenylvaleric Acid Length = 394 Score = 24.4 bits (50), Expect = 131 Identities = 10/18 (55%), Positives = 13/18 (72%), Gaps = 4/18 (22%) Query: 21 MTLDDWA-LATI---TGA 34 +TLD WA +A+I TGA Sbjct: 186 LTLDQWAEIASILEKTGA 203
Score = 18.0 bits (35), Expect = 10772
Identities = 5/6 (83%), Positives = 6/6 (100%)
Query: 254 ASRLPE 259
ASR+PE
Sbjct: 229 ASRIPE 234
Database: PDB protein database
Posted date: Sep 27, 2003 8:18 PM
Number of letters in database: 10,828,398
Number of sequences in database: 45,671
Lambda K H
0.337 0.282 1.71
Gapped
Lambda K H
0.294 0.110 0.610
Matrix: PAM30
Gap Penalties: Existence: 9, Extension: 1
Number of Hits to DB: 866,923
Number of Sequences: 45671
Number of extensions: 94131
Number of successful extensions: 857
Number of sequences better than 20000.0: 705
Number of HSP's better than 20000.0 without gapping: 705
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 853
length of query: 325
length of database: 10,828,398
effective HSP length: 26
effective length of query: 299
effective length of database: 9,640,952
effective search space: 2882644648
effective search space used: 2882644648
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 35 (14.8 bits)
X3: 58 (24.6 bits)
S1: 33 (17.9 bits)
S2: 33 (17.2 bits)